RegulonDB RegulonDB 10.7: Gene Form
   

carB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

carB carA caiF CRP FNR caiFp caiFp TSS_79 TSS_79 TSS_78 TSS_78 TSS_77 TSS_77 carBp carBp

Gene      
Name: carB    Texpresso search in the literature
Synonym(s): ECK0034, EG10135, b0033, cap, pyrA
Genome position(nucleotides): 30817 --> 34038 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.27
External database links:  
ASAP:
ABE-0000121
CGSC:
935
ECHOBASE:
EB0133
MIM:
237300
MIM:
608307
MIM:
615371
MIM:
616457
NCBI-GENE:
944775
OU-MICROARRAY:
b0033
PORTECO:
carB
REGULONDB:
b0033
STRING:
511145.b0033
M3D: carB
COLOMBOS: carB
PortEco: b0033


Product      
Name: carbamoyl phosphate synthetase subunit β
Synonym(s): beta; chain, Cap, CarB, PyrA, carbamoyl phosphate synthetase, beta; chain, large chain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 117.842
Isoelectric point: 4.978
Motif(s):
 
Type Positions Sequence
159 -> 216 AADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEY
957 -> 1041 VVDLAAKLLKQGFELDATHGTAIVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYD
674 -> 876 DRERFQHAVERLKLKQPANATVTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAGKSLAE
128 -> 334 DRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDE
404 -> 553 VGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNIDRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005951 - carbamoyl-phosphate synthase complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016597 - amino acid binding
GO:0004088 - carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0004087 - carbamoyl-phosphate synthase (ammonia) activity
biological_process GO:0006221 - pyrimidine nucleotide biosynthetic process
GO:0006526 - arginine biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0006807 - nitrogen compound metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0019856 - pyrimidine nucleobase biosynthetic process
GO:0044205 - 'de novo' UMP biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-1025N
ECOCYC:
CARBPSYN-LARGE
ECOLIWIKI:
b0033
INTERPRO:
IPR011607
INTERPRO:
IPR006275
INTERPRO:
IPR005483
INTERPRO:
IPR005480
INTERPRO:
IPR005479
INTERPRO:
IPR011761
INTERPRO:
IPR016185
INTERPRO:
IPR036897
INTERPRO:
IPR033937
INTERPRO:
IPR036914
MINT:
MINT-1255866
MODBASE:
P00968
PDB:
1T36
PDB:
1M6V
PDB:
1KEE
PDB:
1JDB
PDB:
1CS0
PDB:
1CE8
PDB:
1C3O
PDB:
1C30
PDB:
1BXR
PDB:
1A9X
PFAM:
PF02787
PFAM:
PF02786
PFAM:
PF02142
PRIDE:
P00968
PRINTS:
PR00098
PRODB:
PRO_000022248
PROSITE:
PS51855
PROSITE:
PS50975
PROSITE:
PS00867
PROSITE:
PS00866
PROTEINMODELPORTAL:
P00968
REFSEQ:
NP_414574
SMART:
SM00851
SMART:
SM01096
SMR:
P00968
UNIPROT:
P00968


Operon      
Name: carAB         
Operon arrangement:
Transcription unit        Promoter
carAB
carAB
carB


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, RutR, Fis
Repressed by: PurR, IHF, ArgR, PepA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_77 31596 forward nd [RS-EPT-CBR] [1]
  promoter TSS_78 31603 forward nd [RS-EPT-CBR] [1]
  promoter TSS_79 34216 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB