RegulonDB RegulonDB 10.8: Gene Form
   

chbB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbC osmE chbB Fis NagC CRP ChbR ChbR NagC terminator chbBp chbBp

Gene      
Name: chbB    Texpresso search in the literature
Synonym(s): ECK1736, EG10140, b1738, celA
Genome position(nucleotides): 1821299 <-- 1821619 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.93
External database links:  
ASAP:
ABE-0005797
CGSC:
34873
ECHOBASE:
EB0138
OU-MICROARRAY:
b1738
PortEco:
chbB
STRING:
511145.b1738
COLOMBOS: chbB


Product      
Name: N,N'-diacetylchitobiose-specific PTS enzyme IIB component
Synonym(s): CelA, ChbB, EIIchb, EIIBcel, Enzyme IIBcel, Enzyme IIBchb
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.427
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
6 -> 94 IYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLK
10 -> 10 C
3 -> 106 KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090566 - protein-phosphocysteine-N,N'-diacetylchitobiose phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
GO:1902815 - N,N'-diacetylchitobiose import
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CELA-MONOMER
ECOLIWIKI:
b1738
INTERPRO:
IPR003501
INTERPRO:
IPR013012
INTERPRO:
IPR036095
MODBASE:
P69795
PDB:
2WWV
PDB:
1IIB
PDB:
1H9C
PDB:
1E2B
PDB:
2WY2
PFAM:
PF02302
PRIDE:
P69795
PRODB:
PRO_000022273
PROSITE:
PS51100
REFSEQ:
NP_416252
SMR:
P69795
UNIPROT:
P69795


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: NagC, ChbR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB