RegulonDB RegulonDB 10.8: Gene Form
   

chbC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbC chbA chbB terminator terminator TSS_2046 TSS_2046

Gene      
Name: chbC    Texpresso search in the literature
Synonym(s): ECK1735, EG10141, b1737, celB, hic
Genome position(nucleotides): 1819856 <-- 1821214 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.23
External database links:  
ASAP:
ABE-0005795
CGSC:
18487
ECHOBASE:
EB0139
OU-MICROARRAY:
b1737
PortEco:
chbC
STRING:
511145.b1737
COLOMBOS: chbC


Product      
Name: N,N'-diacetylchitobiose-specific PTS enzyme IIC component
Synonym(s): CelB, ChbC, EIICcel, EIICchb, Enzyme IICcel, Enzyme IICchb, Hic
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 48.332
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
86 -> 106 VYNGTLGIMSLMAPFFIGMAL
240 -> 265 FVPLLWFFGIHGALALTALDNGIMTP
35 -> 55 LMPLTLAGAMFVLINNVFLSF
405 -> 452 SVAALLVALFNLGIATLIYLPFVVVANKAQNAIDKEESEEDIANALKF
190 -> 205 LIPGFIILSVMGIIAW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0034219 - carbohydrate transmembrane transport
GO:1901264 - carbohydrate derivative transport
GO:1902815 - N,N'-diacetylchitobiose import
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9264N
ECOCYC:
CELB-MONOMER
ECOLIWIKI:
b1737
INTERPRO:
IPR004501
INTERPRO:
IPR003352
INTERPRO:
IPR004796
PFAM:
PF02378
PRIDE:
P17334
PRODB:
PRO_000022274
PROSITE:
PS51105
REFSEQ:
NP_416251
SMR:
P17334
UNIPROT:
P17334


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: ChbR, NagC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2046 1819793 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB