RegulonDB RegulonDB 10.9: Gene Form
   

chbC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbC chbA chbB terminator terminator TSS_2046 TSS_2046

Gene      
Name: chbC    Texpresso search in the literature
Synonym(s): ECK1735, EG10141, b1737, celB, hic
Genome position(nucleotides): 1819856 <-- 1821214 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.23
External database links:  
ASAP:
ABE-0005795
CGSC:
18487
ECHOBASE:
EB0139
ECOLIHUB:
chbC
OU-MICROARRAY:
b1737
STRING:
511145.b1737
COLOMBOS: chbC


Product      
Name: N,N'-diacetylchitobiose-specific PTS enzyme IIC component
Synonym(s): CelB, ChbC, EIICcel, EIICchb, Enzyme IICcel, Enzyme IICchb, Hic
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 48.332
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
86 -> 106 VYNGTLGIMSLMAPFFIGMAL
240 -> 265 FVPLLWFFGIHGALALTALDNGIMTP
35 -> 55 LMPLTLAGAMFVLINNVFLSF
405 -> 452 SVAALLVALFNLGIATLIYLPFVVVANKAQNAIDKEESEEDIANALKF
190 -> 205 LIPGFIILSVMGIIAW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0034219 - carbohydrate transmembrane transport
GO:1901264 - carbohydrate derivative transport
GO:1902815 - N,N'-diacetylchitobiose import
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9264N
ECOCYC:
CELB-MONOMER
ECOLIWIKI:
b1737
INTERPRO:
IPR003352
INTERPRO:
IPR004796
INTERPRO:
IPR004501
PFAM:
PF02378
PRIDE:
P17334
PRODB:
PRO_000022274
PROSITE:
PS51105
REFSEQ:
NP_416251
UNIPROT:
P17334


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: NagC, ChbR


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA chiX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2046 1819793 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB