RegulonDB RegulonDB 10.9: Gene Form
   

chbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbC chbR chbA terminator TSS_2046 TSS_2046

Gene      
Name: chbA    Texpresso search in the literature
Synonym(s): ECK1734, EG10142, b1736, celC
Genome position(nucleotides): 1819455 <-- 1819805 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.86
External database links:  
ASAP:
ABE-0005792
CGSC:
18484
ECHOBASE:
EB0140
ECOLIHUB:
chbA
OU-MICROARRAY:
b1736
STRING:
511145.b1736
COLOMBOS: chbA


Product      
Name: N,N'-diacetylchitobiose-specific PTS enzyme IIA component
Synonym(s): CelC, ChbA, EIIAchb, EIIIchb, Enzyme IIAchb, Enzyme IIIchb
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.748
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
43 -> 44 KQ
52 -> 52 A
14 -> 14 A
19 -> 112 EVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHE
92 -> 92 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0090566 - protein-phosphocysteine-N,N'-diacetylchitobiose phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0034219 - carbohydrate transmembrane transport
GO:1902815 - N,N'-diacetylchitobiose import
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9265N
ECOCYC:
CELC-MONOMER
ECOLIWIKI:
b1736
INTERPRO:
IPR036542
INTERPRO:
IPR003188
MODBASE:
P69791
PANTHER:
PTHR34382
PDB:
2WY2
PDB:
2WWV
PDB:
2LRL
PDB:
2LRK
PDB:
1WCR
PFAM:
PF02255
PRIDE:
P69791
PRODB:
PRO_000022272
PROSITE:
PS51095
REFSEQ:
NP_416250
SMR:
P69791
UNIPROT:
P69791


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: NagC, ChbR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2046 1819793 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB