RegulonDB RegulonDB 10.8: Gene Form
   

cheR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tap cheB cheR TSS_2227 TSS_2227 TSS_2226 TSS_2226 TSS_2225 TSS_2225

Gene      
Name: cheR    Texpresso search in the literature
Synonym(s): ECK1885, EG10148, b1884, cheX
Genome position(nucleotides): 1968504 <-- 1969364 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.24
External database links:  
ASAP:
ABE-0006286
CGSC:
926
ECHOBASE:
EB0146
OU-MICROARRAY:
b1884
PortEco:
cheR
STRING:
511145.b1884
COLOMBOS: cheR


Product      
Name: chemotaxis protein methyltransferase
Synonym(s): CheR, CheX, MCP O-methyltransferase, S-adenosyl-L-methionine:protein-L-glutamate O-methyltransferase, methyl-accepting chemotaxis protein O-methyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 32.849
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
15 -> 286 QMTERLALSDAHFRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRSLGLTDFGHYLNLLESNQHSGEWQAFINSLTTNLTAFFREAHHFPLLADHARRRSGEYRVWSAAASTGEEPYSIAMTLADTLGTAPGRWKVFASDIDTEVLEKARSGIYRHEELKNLTPQQLQRYFMRGTGPHEGLVRVRQELANYVDFAPLNLLAKQYTVPGPFDAIFCRNVMIYFDQTTQQEILRRFVPLLKPDGLLFAGHSENFSHLERRFTLRGQTVYALSKD
26 -> 77 HFRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRSLGLTDFGHYLNLLESNQ
212 -> 213 NL
113 -> 113 R
230 -> 231 RN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0098561 - methyl accepting chemotaxis protein complex
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0008022 - protein C-terminus binding
GO:0008168 - methyltransferase activity
GO:0008276 - protein methyltransferase activity
GO:0016740 - transferase activity
GO:0008757 - S-adenosylmethionine-dependent methyltransferase activity
GO:0008983 - protein-glutamate O-methyltransferase activity
biological_process GO:0006479 - protein methylation
GO:0032259 - methylation
GO:0006935 - chemotaxis
Note(s): Note(s): ...[more].
Reference(s): [1] Burgess-Cassler A., et al., 1982
[2] Kort EN., et al., 1975
[3] Lybarger SR., et al., 1999
[4] Minoshima S., et al., 1980
[5] Minoshima S., et al., 1981
[6] Mutoh N., et al., 1986
[7] Ohba M., et al., 1979
[8] Parkinson JS. 1976
[9] Rollins CM., et al., 1980
[10] Silverman M., et al., 1977
[11] Slocum MK., et al., 1983
[12] Stock JB., et al., 1981
[13] Wolfe AJ., et al., 1987
External database links:  
DIP:
DIP-9273N
ECOCYC:
CHER-MONOMER
ECOLIWIKI:
b1884
INTERPRO:
IPR022641
INTERPRO:
IPR036804
INTERPRO:
IPR029063
INTERPRO:
IPR026024
INTERPRO:
IPR022642
INTERPRO:
IPR000780
MODBASE:
P07364
PFAM:
PF01739
PFAM:
PF03705
PRIDE:
P07364
PRINTS:
PR00996
PRODB:
PRO_000022279
PROSITE:
PS50123
REFSEQ:
NP_416398
SMART:
SM00138
SMR:
P07364
SWISSMODEL:
P07364
UNIPROT:
P07364


Operon      
Name: tar-tap-cheRBYZ         
Operon arrangement:
Transcription unit        Promoter
tar-tap-cheRBYZ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2225 1967578 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_2226 1967584 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_2227 1968082 reverse nd [RS-EPT-CBR] [14]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burgess-Cassler A., Ordal GW., 1982, Functional homology of Bacillus subtilis methyltransferase II and Escherichia coli cheR protein., J Biol Chem 257(21):12835-8

 [2] Kort EN., Goy MF., Larsen SH., Adler J., 1975, Methylation of a membrane protein involved in bacterial chemotaxis., Proc Natl Acad Sci U S A 72(10):3939-43

 [3] Lybarger SR., Maddock JR., 1999, Clustering of the chemoreceptor complex in Escherichia coli is independent of the methyltransferase CheR and the methylesterase CheB., J Bacteriol 181(17):5527-9

 [4] Minoshima S., Hayashi H., 1980, Studies on bacterial chemotaxis. VI. Effect of cheX mutation on the methylation of methyl-accepting chemotaxis protein of Escherichia coli., J Biochem 87(5):1371-7

 [5] Minoshima S., Ohba M., Hayashi H., 1981, An in vitro study of the methylation of methyl-accepting chemotaxis protein of Escherichia coli. Construction of the system and effect of mutant proteins on the system., J Biochem 89(2):411-20

 [6] Mutoh N., Simon MI., 1986, Nucleotide sequence corresponding to five chemotaxis genes in Escherichia coli., J Bacteriol 165(1):161-6

 [7] Ohba M., Hayashi H., 1979, Studies on bacterial chemotaxis. III. Effect of methyl esters on the chemotactic response of Escherichia coli., J Biochem 85(5):1331-8

 [8] Parkinson JS., 1976, cheA, cheB, and cheC genes of Escherichia coli and their role in chemotaxis., J Bacteriol 126(2):758-70

 [9] Rollins CM., Dahlquist FW., 1980, Methylation of chemotaxis-specific proteins in Escherichia coli cells permeable to S-adenosylmethionine., Biochemistry 19(20):4627-32

 [10] Silverman M., Simon M., 1977, Identification of polypeptides necessary for chemotaxis in Escherichia coli., J Bacteriol 130(3):1317-25

 [11] Slocum MK., Parkinson JS., 1983, Genetics of methyl-accepting chemotaxis proteins in Escherichia coli: organization of the tar region., J Bacteriol 155(2):565-77

 [12] Stock JB., Maderis AM., Koshland DE., 1981, Bacterial chemotaxis in the absence of receptor carboxylmethylation., Cell 27(1 Pt 2):37-44

 [13] Wolfe AJ., Conley MP., Kramer TJ., Berg HC., 1987, Reconstitution of signaling in bacterial chemotaxis., J Bacteriol 169(5):1878-85

 [14] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB