RegulonDB RegulonDB 10.8: Gene Form
   

moeA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

moeA iaaA moeB fsaA gsiA NarL ArcA NarL FNR anti-anti-terminator anti-terminator terminator iaaAp iaaAp moeAp moeAp

Gene      
Name: moeA    Texpresso search in the literature
Synonym(s): ECK0817, EG10153, b0827, bisB, chlE, narE
Genome position(nucleotides): 865129 <-- 866364 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.39
External database links:  
ASAP:
ABE-0002823
CGSC:
919
ECHOBASE:
EB0151
MIM:
615501
OU-MICROARRAY:
b0827
PortEco:
moeA
STRING:
511145.b0827
COLOMBOS: moeA


Product      
Name: molybdopterin molybdotransferase
Synonym(s): BisB, ChlE, MoeA, NarE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.067
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
332 -> 404 RVRTASRLKKTPGRLDFQRGVLQRNADGELEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWVEVEPF
182 -> 317 LFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVINLGIIRDDPHALRAAFIEADSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPGKPFAFGKLSNSWFCGLPGNPVSATLTFYQLVQPLLA
9 -> 168 SLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVVSPLDVPGFDNSAMDGYAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPVPEGCEAVVMQEQTEQMDNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPVIASLG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0061598 - molybdopterin adenylyltransferase activity
GO:0061599 - molybdopterin molybdotransferase activity
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
GO:0032324 - molybdopterin cofactor biosynthetic process
GO:0018315 - molybdenum incorporation into molybdenum-molybdopterin complex
External database links:  
DIP:
DIP-10240N
ECOCYC:
EG10153-MONOMER
ECOLIWIKI:
b0827
INTERPRO:
IPR005111
INTERPRO:
IPR005110
INTERPRO:
IPR001453
INTERPRO:
IPR008284
INTERPRO:
IPR036135
INTERPRO:
IPR036425
INTERPRO:
IPR036688
INTERPRO:
IPR038987
MINT:
MINT-1250871
MODBASE:
P12281
PANTHER:
PTHR10192
PDB:
2NRS
PDB:
2NRP
PDB:
2NRO
PDB:
2NQU
PDB:
2NQS
PDB:
2NQR
PDB:
2NQQ
PDB:
2NQN
PDB:
2NQM
PDB:
2NQK
PDB:
1G8R
PDB:
1G8L
PDB:
1FC5
PDB:
2NQV
PFAM:
PF00994
PFAM:
PF03453
PFAM:
PF03454
PRIDE:
P12281
PROSITE:
PS01079
REFSEQ:
NP_415348
SMART:
SM00852
SMR:
P12281
UNIPROT:
P12281


Operon      
Name: moeAB         
Operon arrangement:
Transcription unit        Promoter
moeAB


Transcriptional Regulation      
Display Regulation             
Activated by: ArcA, NarL
Repressed by: FNR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB