RegulonDB RegulonDB 10.9: Gene Form
   

cpxA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: cpxA    Texpresso search in the literature
Synonym(s): ECK3904, EG10163, b3911, ecf, ecfB, eup, rssE, ssd
Genome position(nucleotides): 4103602 <-- 4104975 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.59
External database links:  
ASAP:
ABE-0012772
CGSC:
908
ECHOBASE:
EB0161
ECOLIHUB:
cpxA
OU-MICROARRAY:
b3911
STRING:
511145.b3911
COLOMBOS: cpxA


Product      
Name: sensor histidine kinase CpxA
Synonym(s): CpxA, Ecf, EcfB, Eup, RssE, Ssd
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol,inner membrane
Molecular weight: 51.624
Isoelectric point: 5.575
Motif(s):
 
Type Positions Sequence
185 -> 237 SLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAGASFNQMVTALERMMT
197 -> 197 A
346 -> 454 NPNALESALENIVRNALRYSHTKIEVGFAVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAIQQHRGWVKAEDSPLGGLRLVIWLPLY
248 -> 251 HELR
252 -> 252 T

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0009314 - response to radiation
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0043708 - cell adhesion involved in biofilm formation
GO:0023014 - signal transduction by protein phosphorylation
GO:0036460 - cellular response to cell envelope stress
External database links:  
DIP:
DIP-48358N
ECOCYC:
CPXA-MONOMER
ECOLIWIKI:
b3911
INTERPRO:
IPR005467
INTERPRO:
IPR036097
INTERPRO:
IPR036890
INTERPRO:
IPR038515
INTERPRO:
IPR032404
INTERPRO:
IPR003594
INTERPRO:
IPR003660
INTERPRO:
IPR003661
INTERPRO:
IPR004358
MODBASE:
P0AE82
PDB:
4BIV
PDB:
4BIU
PDB:
4BIX
PDB:
4BIY
PDB:
4BIZ
PDB:
4BIW
PDB:
5LFK
PDB:
4CB0
PFAM:
PF00672
PFAM:
PF02518
PFAM:
PF00512
PFAM:
PF16527
PRIDE:
P0AE82
PRINTS:
PR00344
PRODB:
PRO_000022324
PROSITE:
PS50109
PROSITE:
PS50885
REFSEQ:
NP_418347
SMART:
SM00388
SMART:
SM00304
SMART:
SM00387
SMR:
P0AE82
UNIPROT:
P0AE82


Operon      
Name: cpxRA         
Operon arrangement:
Transcription unit        Promoter
cpxRA
cpxRA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4593 4104614 reverse nd [RS-EPT-CBR] [1]
  promoter cpxAp1 4105101 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4594 4105685 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4596 4106222 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4597 4106224 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4598 4106290 forward nd [RS-EPT-CBR] [1]



RegulonDB