RegulonDB RegulonDB 10.7: Gene Form
   

crr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsI pdxK crr TSS_2732 TSS_2732 TSS_2731 TSS_2731 TSS_2730 (cluster) TSS_2730 (cluster) TSS_2729 (cluster) TSS_2729 (cluster) TSS_2728 (cluster) TSS_2728 (cluster) TSS_2727 TSS_2727 TSS_2726 (cluster) TSS_2726 (cluster) TSS_2725 TSS_2725 TSS_2724 TSS_2724 TSS_2723 TSS_2723 TSS_2722 TSS_2722 TSS_2721 TSS_2721 TSS_2720 TSS_2720 TSS_2719 (cluster) TSS_2719 (cluster) crrpI crrpI crrp2 crrp2 TSS_2718 TSS_2718 TSS_2717 TSS_2717 TSS_2716 TSS_2716 TSS_2715 TSS_2715 TSS_2714 TSS_2714 TSS_2713 TSS_2713 TSS_2712 TSS_2712

Gene      
Name: crr    Texpresso search in the literature
Synonym(s): ECK2412, EG10165, b2417, gsr, iex, tgs, treD
Genome position(nucleotides): 2535834 --> 2536343 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.25
Reference(s): [1] De Reuse H., et al., 1984
[2] De Reuse H., et al., 1985
External database links:  
ASAP:
ABE-0007971
CGSC:
905
ECHOBASE:
EB0163
OU-MICROARRAY:
b2417
PORTECO:
crr
REGULONDB:
b2417
STRING:
511145.b2417
M3D: crr
COLOMBOS: crr
PortEco: b2417


Product      
Name: Enzyme IIAGlc
Synonym(s): Crr, EIIAGlc, EIIIGlc, Enzyme IIAGlc, Crr, Enzyme IIIGlc, Gsr, IIIGlc, Iex, Tgs, TreD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 18.251
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
4 -> 4 F
22 -> 146 EIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLLEEKAKSTLTPVVISNMDE
39 -> 143 DVVFAEKIVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLLEEKAKSTLTPVVISN
1 -> 18 MGLFDKLKSLVSDDKKDT
23 -> 31 IIAPLSGEI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0045912 - negative regulation of carbohydrate metabolic process
GO:0043610 - regulation of carbohydrate utilization
Note(s): Note(s): ...[more].
Reference(s): [3] Jindal S., et al., 2019
[4] Liang Q., et al., 2015
[5] Meadow ND., et al., 2006
[6] Niu H., et al., 2019
[7] Pelton JG., et al., 1992
[8] Pelton JG., et al., 1993
[9] Pelton JG., et al., 1991
[10] Wang G., et al., 2000
[11] Worthylake D., et al., 1991
External database links:  
DIP:
DIP-31863N
ECOCYC:
CRR-MONOMER
ECOLIWIKI:
b2417
INTERPRO:
IPR011055
INTERPRO:
IPR001127
PDB:
1GLD
PDB:
1GLE
PDB:
1O2F
PDB:
2F3G
PDB:
2MP0
PDB:
4JBW
PDB:
1GLC
PDB:
1GLB
PDB:
1GLA
PDB:
1GGR
PDB:
1F3Z
PDB:
1F3G
PFAM:
PF00358
PRIDE:
P69783
PRODB:
PRO_000022334
PROSITE:
PS00371
PROSITE:
PS51093
PROTEINMODELPORTAL:
P69783
REFSEQ:
NP_416912
SMR:
P69783
UNIPROT:
P69783


Operon      
Name: ptsHI-crr         
Operon arrangement:
Transcription unit        Promoter
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
crr
crr


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Cra
Repressed by: CRP, NagC, Mlc, Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2712 2534171 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2713 2534767 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2714 2534771 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2715 2534776 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2716 2535322 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2717 2535452 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2718 2535474 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2719 (cluster) 2535671 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2720 2535696 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2721 2535734 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2722 2535767 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2723 2535778 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2724 2535782 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2725 2535785 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2726 (cluster) 2535792 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2727 2535802 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2728 (cluster) 2535812 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2729 (cluster) 2535819 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2730 (cluster) 2535831 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2731 2535839 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2732 2536064 forward nd [RS-EPT-CBR] [12]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] De Reuse H., Huttner E., Danchin A., 1984, Analysis of the ptsH-ptsI-crr region in Escherichia coli K-12: evidence for the existence of a single transcriptional unit., Gene 32(1-2):31-40

 [2] De Reuse H., Roy A., Danchin A., 1985, Analysis of the ptsH-ptsI-crr region in Escherichia coli K-12: nucleotide sequence of the ptsH gene., Gene 35(1-2):199-207

 [3] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [4] Liang Q., Zhang F., Li Y., Zhang X., Li J., Yang P., Qi Q., 2015, Comparison of individual component deletions in a glucose-specific phosphotransferase system revealed their different applications., Sci Rep 5:13200

 [5] Meadow ND., Savtchenko RS., Remington SJ., Roseman S., 2006, Effects of mutations and truncations on the kinetic behavior of IIAGlc, a phosphocarrier and regulatory protein of the phosphoenolpyruvate phosphotransferase system of Escherichia coli., J Biol Chem 281(17):11450-5

 [6] Niu H., Li R., Gao J., Fan X., Li Q., Gu P., 2019, Different performance of Escherichia coli mutants with defects in the phosphoenolpyruvate: carbohydrate phosphotransferase system under low glucose condition., 3 Biotech 9(2):50

 [7] Pelton JG., Torchia DA., Meadow ND., Roseman S., 1992, Structural comparison of phosphorylated and unphosphorylated forms of IIIGlc, a signal-transducing protein from Escherichia coli, using three-dimensional NMR techniques., Biochemistry 31(22):5215-24

 [8] Pelton JG., Torchia DA., Meadow ND., Roseman S., 1993, Tautomeric states of the active-site histidines of phosphorylated and unphosphorylated IIIGlc, a signal-transducing protein from Escherichia coli, using two-dimensional heteronuclear NMR techniques., Protein Sci 2(4):543-58

 [9] Pelton JG., Torchia DA., Meadow ND., Wong CY., Roseman S., 1991, 1H, 15N, and 13C NMR signal assignments of IIIGlc, a signal-transducing protein of Escherichia coli, using three-dimensional triple-resonance techniques., Biochemistry 30(41):10043-57

 [10] Wang G., Louis JM., Sondej M., Seok YJ., Peterkofsky A., Clore GM., 2000, Solution structure of the phosphoryl transfer complex between the signal transducing proteins HPr and IIA(glucose) of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system., EMBO J 19(21):5635-49

 [11] Worthylake D., Meadow ND., Roseman S., Liao DI., Herzberg O., Remington SJ., 1991, Three-dimensional structure of the Escherichia coli phosphocarrier protein IIIglc., Proc Natl Acad Sci U S A 88(23):10382-6

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB