RegulonDB RegulonDB 10.8: Gene Form
   

cvpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purF dedD cvpA folC PurR anti-terminator terminator cvpAp1 cvpAp1 cvpAp2 cvpAp2

Gene      
Name: cvpA    Texpresso search in the literature
Synonym(s): ECK2307, EG10169, b2313, dedE
Genome position(nucleotides): 2430275 <-- 2430763 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.08
External database links:  
ASAP:
ABE-0007633
CGSC:
32727
ECHOBASE:
EB0167
OU-MICROARRAY:
b2313
PortEco:
cvpA
STRING:
511145.b2313
COLOMBOS: cvpA


Product      
Name: colicin V production protein
Synonym(s): CvpA, DedE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.907
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
1 -> 21 MVWIDYAIIAVIAFSSLVSLI
99 -> 119 VLGVCFGALRGVLIVAAILFF
64 -> 84 IAIAVLFIATLIVGAIVNFVI
32 -> 52 VTWGCAFFVASHYYTYLSVWF
4 -> 141 IDYAIIAVIAFSSLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGVCFGALRGVLIVAAILFFLDSFTGVSKSEDWSKSQLIPQF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0009403 - toxin biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Fath MJ., et al., 1989
External database links:  
DIP:
DIP-9354N
ECOCYC:
EG10169-MONOMER
ECOLIWIKI:
b2313
INTERPRO:
IPR003825
MINT:
MINT-1289958
PFAM:
PF02674
PRIDE:
P08550
PRODB:
PRO_000022356
REFSEQ:
NP_416816
UNIPROT:
P08550


Operon      
Name: cvpA-purF-ubiX         
Operon arrangement:
Transcription unit        Promoter
cvpA-purF-ubiX
cvpA-purF-ubiX
ubiX


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Fath MJ., Mahanty HK., Kolter R., 1989, Characterization of a purF operon mutation which affects colicin V production., J Bacteriol 171(6):3158-61


RegulonDB