RegulonDB RegulonDB 10.8: Gene Form
   

cynS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cynX cynT cynS

Gene      
Name: cynS    Texpresso search in the literature
Synonym(s): ECK0337, EG10175, b0340, cnt, cyaN
Genome position(nucleotides): 359489 --> 359959 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.53
External database links:  
ASAP:
ABE-0001173
CGSC:
15267
ECHOBASE:
EB0172
OU-MICROARRAY:
b0340
PortEco:
cynS
STRING:
511145.b0340
COLOMBOS: cynS


Product      
Name: cyanase
Synonym(s): Cnt, CyaN, CynS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.049
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
34 -> 34 D
74 -> 74 L
87 -> 154 RIPTDPTMYRFYEMLQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTK
125 -> 125 N
68 -> 68 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.24 - cyanate catabolism
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016829 - lyase activity
GO:0008824 - cyanate hydratase activity
biological_process GO:0009439 - cyanate metabolic process
GO:0009440 - cyanate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9365N
ECOCYC:
CYANLY-MONOMER
ECOLIWIKI:
b0340
INTERPRO:
IPR003712
INTERPRO:
IPR010982
INTERPRO:
IPR036581
INTERPRO:
IPR008076
MODBASE:
P00816
PANTHER:
PTHR34186
PDB:
2IVG
PDB:
2IVB
PDB:
2IV1
PDB:
2IUO
PDB:
2IU7
PDB:
1DWK
PDB:
1DW9
PDB:
2IVQ
PFAM:
PF02560
PRIDE:
P00816
PRINTS:
PR01693
PRODB:
PRO_000022366
REFSEQ:
NP_414874
SMART:
SM01116
SMR:
P00816
UNIPROT:
P00816


Operon      
Name: cynTSX         
Operon arrangement:
Transcription unit        Promoter
cynTS
cynTSX


Transcriptional Regulation      
Display Regulation             
Activated by: CynR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB