RegulonDB RegulonDB 10.8: Gene Form
   

cynT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cynR cynT cynS CynR CynR cynTp cynTp cynRp cynRp

Gene      
Name: cynT    Texpresso search in the literature
Synonym(s): ECK0336, EG10176, b0339
Genome position(nucleotides): 358799 --> 359458 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.27
External database links:  
ASAP:
ABE-0001171
CGSC:
31258
ECHOBASE:
EB0173
OU-MICROARRAY:
b0339
PortEco:
cynT
STRING:
511145.b0339
COLOMBOS: cynT


Product      
Name: carbonic anhydrase 1
Synonym(s): CynT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.764
Isoelectric point: 7.468
Motif(s):
 
Type Positions Sequence
174 -> 176 RIA
212 -> 212 P
34 -> 188 TLFISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAMTAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTHPSVRLALEEGRIALHGWVYDIESGS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.24 - cyanate catabolism
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004089 - carbonate dehydratase activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0009440 - cyanate catabolic process
GO:0015976 - carbon utilization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47965N
ECOCYC:
CARBODEHYDRAT-MONOMER
ECOLIWIKI:
b0339
INTERPRO:
IPR036874
INTERPRO:
IPR015892
INTERPRO:
IPR001765
MODBASE:
P0ABE9
PANTHER:
PTHR11002
PFAM:
PF00484
PRIDE:
P0ABE9
PROSITE:
PS00704
PROSITE:
PS00705
REFSEQ:
NP_414873
SMART:
SM00947
SMR:
P0ABE9
UNIPROT:
P0ABE9


Operon      
Name: cynTSX         
Operon arrangement:
Transcription unit        Promoter
cynTS
cynTSX


Transcriptional Regulation      
Display Regulation             
Activated by: CynR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB