RegulonDB RegulonDB 10.8: Gene Form
   

cyoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cyoB ampG cyoA ampG-int cyoC Cra Fur ArcA FNR CRP PdhR CRP CusR HprR cyoAp cyoAp TSS_553 TSS_553 TSS_552 TSS_552

Gene      
Name: cyoA    Texpresso search in the literature
Synonym(s): ECK0426, EG10178, b0432
Genome position(nucleotides): 450663 <-- 451610 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.95
External database links:  
ASAP:
ABE-0001495
CGSC:
18439
ECHOBASE:
EB0175
MIM:
220110
OU-MICROARRAY:
b0432
PortEco:
cyoA
STRING:
511145.b0432
COLOMBOS: cyoA


Product      
Name: cytochrome bo3 ubiquinol oxidase subunit 2
Synonym(s): CyoA, cytochrome bo3 terminal oxidase subunit II, cytochrome bo3 ubiquinol oxidase subunit II, cytochrome o ubiquinol oxidase subunit II
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.911
Isoelectric point: 7.337
Motif(s):
 
Type Positions Sequence
93 -> 111 WTVPILIIIFLAVLTWKTT
136 -> 136 W
1 -> 24 MRLRKYNKSLGWLSLFAGTVLLSG
51 -> 68 MLIVVIPAILMAVGFAWK
148 -> 218 ATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0070469 - respirasome
GO:0009319 - cytochrome o ubiquinol oxidase complex
GO:0071575 - integral component of external side of plasma membrane
molecular_function GO:0005507 - copper ion binding
GO:0009055 - electron transfer activity
GO:0015453 - oxidoreduction-driven active transmembrane transporter activity
GO:0016491 - oxidoreductase activity
GO:0015078 - proton transmembrane transporter activity
GO:0004129 - cytochrome-c oxidase activity
GO:0008827 - cytochrome o ubiquinol oxidase activity
GO:0009486 - cytochrome bo3 ubiquinol oxidase activity
GO:0016682 - oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
biological_process GO:0009060 - aerobic respiration
GO:0015990 - electron transport coupled proton transport
GO:0019646 - aerobic electron transport chain
GO:0042773 - ATP synthesis coupled electron transport
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Abramson J., et al., 2000
[2] Brokx SJ., et al., 2004
[3] Gonnet P., et al., 2004
[4] Jahn LJ., et al., 2017
[5] Lobritz MA., et al., 2015
[6] Welter R., et al., 1994
[7] van der Oost J., et al., 1993
External database links:  
DIP:
DIP-47942N
DISPROT:
DP00089
ECOCYC:
CYOA-MONOMER
ECOLIWIKI:
b0432
INTERPRO:
IPR010514
INTERPRO:
IPR036257
INTERPRO:
IPR034227
INTERPRO:
IPR011759
INTERPRO:
IPR008972
INTERPRO:
IPR006333
INTERPRO:
IPR002429
MODBASE:
P0ABJ1
PDB:
1CYW
PDB:
1CYX
PDB:
1FFT
PFAM:
PF00116
PFAM:
PF06481
PRIDE:
P0ABJ1
PRODB:
PRO_000022368
PROSITE:
PS50857
PROSITE:
PS51257
PROSITE:
PS50999
REFSEQ:
NP_414966
SMR:
P0ABJ1
UNIPROT:
P0ABJ1


Operon      
Name: cyoABCDE         
Operon arrangement:
Transcription unit        Promoter
cyoABCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, CusR, GadE, Fis
Repressed by: FNR, Fur, HprR, Cra, ArcA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_552 448681 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_553 449899 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Abramson J., Riistama S., Larsson G., Jasaitis A., Svensson-Ek M., Laakkonen L., Puustinen A., Iwata S., Wikstrom M., 2000, The structure of the ubiquinol oxidase from Escherichia coli and its ubiquinone binding site., Nat Struct Biol 7(10):910-7

 [2] Brokx SJ., Ellison M., Locke T., Bottorff D., Frost L., Weiner JH., 2004, Genome-wide analysis of lipoprotein expression in Escherichia coli MG1655., J Bacteriol 186(10):3254-8

 [3] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [4] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [5] Lobritz MA., Belenky P., Porter CB., Gutierrez A., Yang JH., Schwarz EG., Dwyer DJ., Khalil AS., Collins JJ., 2015, Antibiotic efficacy is linked to bacterial cellular respiration., Proc Natl Acad Sci U S A 112(27):8173-80

 [6] Welter R., Gu LQ., Yu L., Yu CA., Rumbley J., Gennis RB., 1994, Identification of the ubiquinol-binding site in the cytochrome bo3-ubiquinol oxidase of Escherichia coli., J Biol Chem 269(46):28834-8

 [7] van der Oost J., Musacchio A., Pauptit RA., Ceska TA., Wierenga RK., Saraste M., 1993, Crystallization and preliminary X-ray analysis of the periplasmic fragment of CyoA-a subunit of the Escherichia coli cytochrome o complex., J Mol Biol 229(3):794-6

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB