RegulonDB RegulonDB 10.6.3: Gene Form
   

cysA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysA cysM cysW cysU anti-terminator terminator TSS_2741 TSS_2741 TSS_2740 TSS_2740 TSS_2739 TSS_2739 TSS_2738 TSS_2738 TSS_2737 TSS_2737 TSS_2736 TSS_2736 TSS_2735 TSS_2735 TSS_2734 TSS_2734

Gene      
Name: cysA    Texpresso search in the literature
Synonym(s): ECK2417, EG10183, b2422
Genome position(nucleotides): 2539717 <-- 2540814 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.65
External database links:  
ASAP:
ABE-0007986
CGSC:
898
ECHOBASE:
EB0180
ECOCYC:
EG10183
ECOLIHUB:
cysA
OU-MICROARRAY:
b2422
REGULONDB:
b2422
STRING:
511145.b2422
M3D: cysA
COLOMBOS: cysA
PortEco: b2422


Product      
Name: sulfate/thiosulfate ABC transporter ATP binding subunit
Synonym(s): CysA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 41.059
Isoelectric point: 7.571
Motif(s):
 
Type Positions Sequence
35 -> 42 GPSGSGKT
136 -> 137 QL
289 -> 339 DSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTVVMHGDDAPQRGERLFVG
3 -> 237 IEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARDRKVGFVFQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFM
137 -> 140 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015419 - ATPase-coupled sulfate transmembrane transporter activity
biological_process GO:0099133 - ATP hydrolysis coupled anion transmembrane transport
GO:0008272 - sulfate transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9373N
ECOCYC:
CYSA-MONOMER
ECOLIWIKI:
b2422
INTERPRO:
IPR027417
INTERPRO:
IPR024765
INTERPRO:
IPR017871
INTERPRO:
IPR014769
INTERPRO:
IPR008995
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR005666
MINT:
MINT-1267862
MODBASE:
P16676
PANTHER:
PTHR24220:SF48
PFAM:
PF12857
PFAM:
PF00005
PRIDE:
P16676
PRODB:
PRO_000022373
PROSITE:
PS00211
PROSITE:
PS51237
PROSITE:
PS50893
PROTEINMODELPORTAL:
P16676
REFSEQ:
NP_416917
SMART:
SM00382
SMR:
P16676
SWISSMODEL:
P16676
UNIPROT:
P16676


Operon      
Name: cysPUWAM         
Operon arrangement:
Transcription unit        Promoter
cysPUWAM


Transcriptional Regulation      
Display Regulation             
Activated by: CysB
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2734 2539529 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2735 2539540 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2736 2539646 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2737 2539652 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2738 2539704 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2739 2540872 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2740 2540960 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2741 2541513 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB