RegulonDB RegulonDB 10.7: Gene Form
   

cysB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

topA cysB ymiA YjjQ CysB PhoP terminator ymiAp6 ymiAp6 ymiAp ymiAp ymiAp7 ymiAp7 TSS_1721 TSS_1721 TSS_1720 TSS_1720 TSS_1719 TSS_1719 cysBp cysBp TSS_1718 TSS_1718 TSS_1717 TSS_1717 TSS_1716 TSS_1716 TSS_1715 TSS_1715

Gene      
Name: cysB    Texpresso search in the literature
Synonym(s): ECK1269, EG10184, b1275
Genome position(nucleotides): 1333855 --> 1334829 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.31
External database links:  
ASAP:
ABE-0004279
CGSC:
897
ECHOBASE:
EB0181
OU-MICROARRAY:
b1275
PORTECO:
cysB
REGULONDB:
b1275
STRING:
511145.b1275
M3D: cysB
COLOMBOS: cysB
PortEco: b1275


Product      
Name: DNA-binding transcriptional dual regulator CysB
Synonym(s): CysB, positive transcriptional regulator for cysteine regulon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 36.15
Isoelectric point: 7.468
Motif(s):
 
Type Positions Sequence
1 -> 59 MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTQV
19 -> 38 VSSTAEGLYTSQPGISKQVR
92 -> 292 KGSLYIATTHTQARYALPNVIKGFIERYPRVSLHMHQGSPTQIADAVSKGNADFAIATEALHLYEDLVMLPCYHWNRAIVVTPDHPLAGKKAITIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVADPDLVRVDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFA
3 -> 64 LQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTQVTPAGQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.12 - cysteine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
biological_process GO:0010165 - response to X-ray
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0008652 - cellular amino acid biosynthetic process
GO:0019344 - cysteine biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Bielinska A., et al., 1986
[2] Kredich NM. 1992
[3] Ostrowski J., et al., 1987
[4] Prodromou C., et al., 1992
[5] Tei H., et al., 1990
External database links:  
DIP:
DIP-36048N
ECOCYC:
PD00232
ECOLIWIKI:
b1275
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
INTERPRO:
IPR005119
MINT:
MINT-1276319
MODBASE:
P0A9F3
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P0A9F3
PRINTS:
PR00039
PRODB:
PRO_000022374
PROSITE:
PS50931
PROTEINMODELPORTAL:
P0A9F3
REFSEQ:
NP_415791
SMR:
P0A9F3
SWISSMODEL:
P0A9F3
UNIPROT:
P0A9F3


Operon      
Name: cysB         
Operon arrangement:
Transcription unit        Promoter
cysB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP
Repressed by: CysB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1715 1331232 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1716 1331471 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1717 1332403 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1718 1333761 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1719 1334133 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1720 1334254 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1721 1334325 forward nd [RS-EPT-CBR] [6]
  promoter ymiAp7 1335056 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter ymiAp6 1335105 forward Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bielinska A., Hulanicka D., 1986, Regulation of the cysB gene expression in Escherichia coli., Acta Biochim Pol 33(2):133-7

 [2] Kredich NM., 1992, The molecular basis for positive regulation of cys promoters in Salmonella typhimurium and Escherichia coli., Mol Microbiol 6(19):2747-53

 [3] Ostrowski J., Jagura-Burdzy G., Kredich NM., 1987, DNA sequences of the cysB regions of Salmonella typhimurium and Escherichia coli., J Biol Chem 262(13):5999-6005

 [4] Prodromou C., Artymiuk PJ., Guest JR., 1992, The aconitase of Escherichia coli. Nucleotide sequence of the aconitase gene and amino acid sequence similarity with mitochondrial aconitases, the iron-responsive-element-binding protein and isopropylmalate isomerases., Eur J Biochem 204(2):599-609

 [5] Tei H., Watanabe K., Murata K., Kimura A., 1990, Analysis of the Escherichia coli K-12 cysB gene and its product using the method of gene fusion., Biochem Biophys Res Commun 167(3):962-9

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB