RegulonDB RegulonDB 10.8: Gene Form
   

cysD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysN iap cysD CysB TSS_3042 TSS_3042 iapp6 iapp6 iapp7 iapp7 TSS_3041 TSS_3041 cysDp cysDp TSS_3040 TSS_3040 TSS_3039 TSS_3039 cysCp3 cysCp3

Gene      
Name: cysD    Texpresso search in the literature
Synonym(s): ECK2747, EG10186, b2752
Genome position(nucleotides): 2875421 <-- 2876329 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.03
External database links:  
ASAP:
ABE-0009029
CGSC:
895
ECHOBASE:
EB0183
OU-MICROARRAY:
b2752
PortEco:
cysD
STRING:
511145.b2752
COLOMBOS: cysD


Shine dalgarno      
Sequence: cggtattgcaAAGGAAcggtTAT


Product      
Name: sulfate adenylyltransferase subunit 2
Synonym(s): CysD, sulfate adenylyltransferase, CysD subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.188
Isoelectric point: 8.229
Motif(s):
 
Type Positions Sequence
180 -> 180 S
29 -> 257 NPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIKKRMVRFRTLGCWPLTGA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0009336 - sulfate adenylyltransferase complex (ATP)
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004781 - sulfate adenylyltransferase (ATP) activity
biological_process GO:0006790 - sulfur compound metabolic process
GO:0006979 - response to oxidative stress
GO:0000103 - sulfate assimilation
GO:0019419 - sulfate reduction
GO:0070814 - hydrogen sulfide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-360N
ECOCYC:
CYSD-MONOMER
ECOLIWIKI:
b2752
INTERPRO:
IPR011784
INTERPRO:
IPR014729
INTERPRO:
IPR002500
MODBASE:
P21156
PFAM:
PF01507
PRIDE:
P21156
PRODB:
PRO_000022376
REFSEQ:
NP_417232
SMR:
P21156
SWISSMODEL:
P21156
UNIPROT:
P21156


Operon      
Name: cysDNC         
Operon arrangement:
Transcription unit        Promoter
cysDNC


Transcriptional Regulation      
Display Regulation             
Activated by: CysB


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cysCp3 2874028 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3039 2875496 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3040 2875544 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3041 2876370 reverse nd [RS-EPT-CBR] [2]
  promoter iapp7 2876536 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter iapp6 2876544 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3042 2876547 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB