RegulonDB RegulonDB 10.8: Gene Form
   

cysG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysG nirC yhfL yhfLp4 yhfLp4 yhfLp8 yhfLp8 yhfLp7 yhfLp7 yhfLp5 yhfLp5 cysGp2 cysGp2 cysGp1 cysGp1

Gene      
Name: cysG    Texpresso search in the literature
Synonym(s): ECK3356, EG10188, b3368
Genome position(nucleotides): 3497828 --> 3499201 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.66
Reference(s): [1] Peakman T., et al., 1990
[2] Tei H., et al., 1990
External database links:  
ASAP:
ABE-0011010
CGSC:
893
ECHOBASE:
EB0185
OU-MICROARRAY:
b3368
PortEco:
cysG
STRING:
511145.b3368
COLOMBOS: cysG


Product      
Name: siroheme synthase
Synonym(s): CysG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.951
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
150 -> 207 HLGQVAKYAGQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLANNDQKAITETTEQL
227 -> 227 D
248 -> 248 D
298 -> 298 R
301 -> 303 GGD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.12 - heme, porphyrine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0016829 - lyase activity
GO:0016491 - oxidoreductase activity
GO:0004325 - ferrochelatase activity
GO:0004851 - uroporphyrin-III C-methyltransferase activity
GO:0043115 - precorrin-2 dehydrogenase activity
GO:0051266 - sirohydrochlorin ferrochelatase activity
GO:0042803 - protein homodimerization activity
GO:0051287 - NAD binding
biological_process GO:0008152 - metabolic process
GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0006970 - response to osmotic stress
GO:0009236 - cobalamin biosynthetic process
GO:0032259 - methylation
GO:0055114 - oxidation-reduction process
GO:0019354 - siroheme biosynthetic process
External database links:  
ECOCYC:
SIROHEMESYN-MONOMER
ECOLIWIKI:
b3368
INTERPRO:
IPR012409
INTERPRO:
IPR037115
INTERPRO:
IPR036291
INTERPRO:
IPR035996
INTERPRO:
IPR000878
INTERPRO:
IPR003043
INTERPRO:
IPR006366
INTERPRO:
IPR006367
INTERPRO:
IPR014776
INTERPRO:
IPR014777
INTERPRO:
IPR019478
INTERPRO:
IPR028281
MODBASE:
P0AEA8
PFAM:
PF10414
PFAM:
PF00590
PFAM:
PF14824
PRIDE:
P0AEA8
PRODB:
PRO_000022378
PROSITE:
PS00839
PROSITE:
PS00840
REFSEQ:
NP_417827
SMR:
P0AEA8
SWISSMODEL:
P0AEA8
UNIPROT:
P0AEA8


Operon      
Name: nirBDC-cysG         
Operon arrangement:
Transcription unit        Promoter
nirBDC-cysG
cysG
cysG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP
Repressed by: CRP, H-NS, IHF, Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhfLp5 3499311 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yhfLp7 3499413 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yhfLp8 3499433 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yhfLp4 3499438 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Peakman T., Crouzet J., Mayaux JF., Busby S., Mohan S., Harborne N., Wootton J., Nicolson R., Cole J., 1990, Nucleotide sequence, organisation and structural analysis of the products of genes in the nirB-cysG region of the Escherichia coli K-12 chromosome., Eur J Biochem 191(2):315-23

 [2] Tei H., Murata K., Kimura A., 1990, Molecular cloning of the cys genes (cysC, cysD, cysH, cysI, cysJ, and cysG) responsible for cysteine biosynthesis in Escherichia coli K-12., Biotechnol Appl Biochem 12(2):212-6

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB