RegulonDB RegulonDB 10.8: Gene Form
   

cysK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysK cysZ ptsH CRP Cra NagC Mlc CRP CysB TSS_2709 TSS_2709 TSS_2708 TSS_2708 TSS_2707 TSS_2707 TSS_2706 TSS_2706 TSS_2705 (cluster) TSS_2705 (cluster) TSS_2704 TSS_2704 TSS_2703 TSS_2703 TSS_2702 TSS_2702 ptsHp1 ptsHp1 ptsHp2 ptsHp2 TSS_2700 TSS_2700 TSS_2699 TSS_2699 TSS_2698 TSS_2698 ptsHp3 ptsHp3 ptsHp4 ptsHp4 ptsHp5 ptsHp5 TSS_2695 TSS_2695 TSS_2694 (cluster) TSS_2694 (cluster) TSS_2693 (cluster) TSS_2693 (cluster) cysKp1 cysKp1 TSS_2691 TSS_2691 cysKp2 cysKp2

Gene      
Name: cysK    Texpresso search in the literature
Synonym(s): ECK2409, EG10192, b2414, ssi5
Genome position(nucleotides): 2532409 --> 2533380 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.31
External database links:  
ASAP:
ABE-0007957
CGSC:
889
ECHOBASE:
EB0189
OU-MICROARRAY:
b2414
PortEco:
cysK
STRING:
511145.b2414
COLOMBOS: cysK


Product      
Name: cysteine synthase A
Synonym(s): O-acetylserine sulfhydrylase A, CysK, Ssi5
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.49
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
42 -> 42 K
10 -> 300 LTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILP
177 -> 181 GTGGT
182 -> 182 L
2 -> 323 SKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.12 - cysteine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009333 - cysteine synthase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016829 - lyase activity
GO:0004124 - cysteine synthase activity
GO:0030170 - pyridoxal phosphate binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0080146 - L-cysteine desulfhydrase activity
GO:0050272 - S-carboxymethylcysteine synthase activity
biological_process GO:0008152 - metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0019344 - cysteine biosynthetic process
GO:0006535 - cysteine biosynthetic process from serine
External database links:  
DIP:
DIP-36170N
ECOCYC:
ACSERLYA-MONOMER
ECOLIWIKI:
b2414
INTERPRO:
IPR005856
INTERPRO:
IPR036052
INTERPRO:
IPR005859
INTERPRO:
IPR001926
INTERPRO:
IPR001216
MINT:
MINT-1240013
MODBASE:
P0ABK5
PDB:
5J43
PDB:
5J5V
PFAM:
PF00291
PRIDE:
P0ABK5
PRODB:
PRO_000022382
PROSITE:
PS00901
REFSEQ:
NP_416909
SMR:
P0ABK5
SWISSMODEL:
P0ABK5
UNIPROT:
P0ABK5


Operon      
Name: cysK         
Operon arrangement:
Transcription unit        Promoter
cysK
cysK


Transcriptional Regulation      
Display Regulation             
Activated by: CysB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2691 2532374 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2693 (cluster) 2532385 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2694 (cluster) 2532396 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2695 2533311 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2698 2533520 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2699 2533592 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2700 2533595 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2702 2533654 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2703 2533658 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2704 2533688 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2705 (cluster) 2533691 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2706 2533744 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2707 2533746 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2708 2533930 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2709 2533978 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB