RegulonDB RegulonDB 10.6.3: Gene Form
   

cysP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysP cysW cysU ucpA cysA CysB cysPp cysPp TSS_2741 TSS_2741 TSS_2740 TSS_2740 TSS_2739 TSS_2739

Gene      
Name: cysP    Texpresso search in the literature
Synonym(s): ECK2420, EG10195, b2425
Genome position(nucleotides): 2542512 <-- 2543528 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.79
External database links:  
ASAP:
ABE-0007992
CGSC:
27367
ECHOBASE:
EB0192
ECOCYC:
EG10195
ECOLIHUB:
cysP
OU-MICROARRAY:
b2425
REGULONDB:
b2425
STRING:
511145.b2425
M3D: cysP
COLOMBOS: cysP
PortEco: b2425


Product      
Name: thiosulfate/sulfate ABC transporter periplasmic binding protein CysP
Synonym(s): CysP, TSBP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 37.615
Isoelectric point: 8.609
Motif(s):
 
Type Positions Sequence
26 -> 338 TELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYRVNNPEVMDKLKDKFPQTELFRVEDKFGSWPEVMKTHFTSGGELDKLLAAGRN
1 -> 25 MAVNLLKKNSLALVASLLLAGHVQA
38 -> 286 ELFAALNPPFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0036173 - thiosulfate binding
GO:0015419 - ATPase-coupled sulfate transmembrane transporter activity
GO:0043199 - sulfate binding
GO:1901681 - sulfur compound binding
biological_process GO:0015709 - thiosulfate transport
GO:0099133 - ATP hydrolysis coupled anion transmembrane transport
GO:0006790 - sulfur compound metabolic process
GO:0008272 - sulfate transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9384N
ECOCYC:
CYSP-MONOMER
ECOLIWIKI:
b2425
INTERPRO:
IPR034408
INTERPRO:
IPR005669
INTERPRO:
IPR000957
MODBASE:
P16700
PANTHER:
PTHR30368
PFAM:
PF13531
PRIDE:
P16700
PRODB:
PRO_000022385
PROSITE:
PS00757
PROSITE:
PS00401
PROTEINMODELPORTAL:
P16700
REFSEQ:
NP_416920
SMR:
P16700
SWISSMODEL:
P16700
UNIPROT:
P16700


Operon      
Name: cysPUWAM         
Operon arrangement:
Transcription unit        Promoter
cysPUWAM


Transcriptional Regulation      
Display Regulation             
Activated by: CysB
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2739 2540872 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2740 2540960 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2741 2541513 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB