RegulonDB RegulonDB 10.8: Gene Form
   

cysS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysS ybcI ppiB cysSp cysSp TSS_678 TSS_678 TSS_677 (cluster) TSS_677 (cluster) TSS_676 TSS_676 TSS_675 TSS_675 TSS_674 (cluster) TSS_674 (cluster)

Gene      
Name: cysS    Texpresso search in the literature
Synonym(s): ECK0519, EG10196, b0526, syc
Genome position(nucleotides): 554611 --> 555996 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.47
External database links:  
ASAP:
ABE-0001810
CGSC:
888
ECHOBASE:
EB0193
MIM:
616672
OU-MICROARRAY:
b0526
PortEco:
cysS
STRING:
511145.b0526
COLOMBOS: cysS


Product      
Name: cysteine—tRNA ligase
Synonym(s): CysRS, CysS, Syc
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.202
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
15 -> 313 FKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQAR
30 -> 40 ITVYDLCHIGH
266 -> 270 KMSKS
316 -> 316 L
341 -> 402 RFIEAMDDDFNTPEAYSVLFDMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0004817 - cysteine-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
biological_process GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006423 - cysteinyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang CM., et al., 2008
External database links:  
DIP:
DIP-9386N
ECOCYC:
CYSS-MONOMER
ECOLIWIKI:
b0526
INTERPRO:
IPR014729
INTERPRO:
IPR032678
INTERPRO:
IPR024909
INTERPRO:
IPR015803
INTERPRO:
IPR015273
INTERPRO:
IPR009080
MINT:
MINT-1240309
MODBASE:
P21888
PANTHER:
PTHR10890
PDB:
1LI5
PDB:
1LI7
PDB:
1U0B
PFAM:
PF09190
PFAM:
PF01406
PRIDE:
P21888
PRINTS:
PR00983
PRODB:
PRO_000022387
PROSITE:
PS00178
REFSEQ:
NP_415059
SMART:
SM00840
SMR:
P21888
UNIPROT:
P21888


Operon      
Name: cysS         
Operon arrangement:
Transcription unit        Promoter
cysS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_674 (cluster) 554360 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_675 554367 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_676 554460 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_677 (cluster) 554490 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_678 554492 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Zhang CM., Liu C., Christian T., Gamper H., Rozenski J., Pan D., Randolph JB., Wickstrom E., Cooperman BS., Hou YM., 2008, Pyrrolo-C as a molecular probe for monitoring conformations of the tRNA 3' end., RNA 14(10):2245-53

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB