RegulonDB RegulonDB 10.6.3: Gene Form
   

cysW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysA cysP cysM cysW cysU anti-terminator terminator TSS_2741 TSS_2741 TSS_2740 TSS_2740 TSS_2739 TSS_2739 TSS_2738 TSS_2738 TSS_2737 TSS_2737 TSS_2736 TSS_2736 TSS_2735 TSS_2735 TSS_2734 TSS_2734

Gene      
Name: cysW    Texpresso search in the literature
Synonym(s): ECK2418, EG10198, b2423
Genome position(nucleotides): 2540804 <-- 2541679 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.62
External database links:  
ASAP:
ABE-0007988
CGSC:
27371
ECHOBASE:
EB0195
ECOCYC:
EG10198
ECOLIHUB:
cysW
OU-MICROARRAY:
b2423
REGULONDB:
b2423
STRING:
511145.b2423
M3D: cysW
COLOMBOS: cysW
PortEco: b2423


Product      
Name: sulfate/thiosulfate ABC transporter inner membrane subunit CysW
Synonym(s): CysW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.538
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
105 -> 125 LLDIPFAVSPVVAGLVYLLFY
248 -> 268 TVGSFTAAALLTLMAIITLFL
81 -> 275 LVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWR
142 -> 162 IMFSWPGMVLVTIFVTCPFVV
201 -> 221 WALLYGVVLTNARAIGEFGAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015116 - sulfate transmembrane transporter activity
GO:0015419 - ATPase-coupled sulfate transmembrane transporter activity
biological_process GO:0099133 - ATP hydrolysis coupled anion transmembrane transport
GO:0008272 - sulfate transport
GO:0055085 - transmembrane transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9388N
ECOCYC:
CYSW-MONOMER
ECOLIWIKI:
b2423
INTERPRO:
IPR000515
INTERPRO:
IPR035906
INTERPRO:
IPR011866
INTERPRO:
IPR005667
MINT:
MINT-1250777
PANTHER:
PTHR30406
PANTHER:
PTHR30406:SF1
PFAM:
PF00528
PRIDE:
P0AEB0
PRODB:
PRO_000022389
PROSITE:
PS50928
PROTEINMODELPORTAL:
P0AEB0
REFSEQ:
YP_026168
SMR:
P0AEB0
UNIPROT:
P0AEB0


Operon      
Name: cysPUWAM         
Operon arrangement:
Transcription unit        Promoter
cysPUWAM


Transcriptional Regulation      
Display Regulation             
Activated by: CysB
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2734 2539529 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2735 2539540 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2736 2539646 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2737 2539652 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2738 2539704 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2739 2540872 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2740 2540960 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2741 2541513 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB