RegulonDB RegulonDB 10.6.3: Gene Form
   

dacC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacC deoR gstB yliI dacCp dacCp TSS_988 TSS_988 gstBp gstBp

Gene      
Name: dacC    Texpresso search in the literature
Synonym(s): ECK0829, EG10203, b0839
Genome position(nucleotides): 880727 --> 881929 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.7
External database links:  
ASAP:
ABE-0002860
CGSC:
34706
ECHOBASE:
EB0199
ECOCYC:
EG10203
ECOLIHUB:
dacC
OU-MICROARRAY:
b0839
REGULONDB:
b0839
STRING:
511145.b0839
M3D: dacC
COLOMBOS: dacC
PortEco: b0839


Product      
Name: D-alanyl-D-alanine carboxypeptidase DacC
Synonym(s): DacC, PBP6, PBP6a, murein DD-carboxypeptidase, penicillin-binding protein 6
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 43.609
Isoelectric point: 8.375
Motif(s):
 
Type Positions Sequence
285 -> 376 FETVTPIKPDATFVTQRVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNGKSIEQRPLIVMENVEE
30 -> 266 QTVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKT
132 -> 134 SGN
231 -> 231 V
235 -> 238 KTGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004180 - carboxypeptidase activity
GO:0004175 - endopeptidase activity
GO:0009002 - serine-type D-Ala-D-Ala carboxypeptidase activity
GO:0008658 - penicillin binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006508 - proteolysis
GO:0009252 - peptidoglycan biosynthetic process
GO:0042493 - response to drug
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
External database links:  
ECOCYC:
EG10203-MONOMER
ECOLIWIKI:
b0839
INTERPRO:
IPR018044
INTERPRO:
IPR037167
INTERPRO:
IPR015956
INTERPRO:
IPR012907
INTERPRO:
IPR012338
INTERPRO:
IPR001967
MINT:
P08506
MODBASE:
P08506
PDB:
3ITA
PDB:
3ITB
PDB:
3IT9
PFAM:
PF07943
PFAM:
PF00768
PRIDE:
P08506
PRINTS:
PR00725
PRODB:
PRO_000022394
PROTEINMODELPORTAL:
P08506
REFSEQ:
NP_415360
SMART:
SM00936
SMR:
P08506
SWISSMODEL:
P08506
UNIPROT:
P08506


Operon      
Name: dacC         
Operon arrangement:
Transcription unit        Promoter
dacC


Transcriptional Regulation      
Display Regulation             
Activated by: BolA
Repressed by: BolA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_988 880618 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB