RegulonDB RegulonDB 10.8: Gene Form
   

dapA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bamC dapA gcvR anti-anti-terminator anti-terminator bcpp bcpp TSS_2774 TSS_2774 TSS_2773 TSS_2773 gcvRp gcvRp gcvRp2 gcvRp2 dapAp dapAp TSS_2770 TSS_2770 TSS_2769 TSS_2769 bamCp bamCp TSS_2768 TSS_2768

Gene      
Name: dapA    Texpresso search in the literature
Synonym(s): ECK2474, EG10205, b2478
Genome position(nucleotides): 2598882 <-- 2599760 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.76
External database links:  
ASAP:
ABE-0008163
CGSC:
880
ECHOBASE:
EB0201
OU-MICROARRAY:
b2478
PortEco:
dapA
STRING:
511145.b2478
COLOMBOS: dapA


Product      
Name: 4-hydroxy-tetrahydrodipicolinate synthase
Synonym(s): DHDPS, DapA, dihydrodipicolinate synthase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.27
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
44 -> 44 T
207 -> 207 A
133 -> 133 Y
2 -> 288 FTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKH
138 -> 138 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0008840 - 4-hydroxy-tetrahydrodipicolinate synthase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0019877 - diaminopimelate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Truffa-Bachi P., et al., 1967
External database links:  
ECOCYC:
DIHYDRODIPICSYN-MONOMER
ECOLIWIKI:
b2478
INTERPRO:
IPR020624
INTERPRO:
IPR013785
INTERPRO:
IPR005263
INTERPRO:
IPR002220
INTERPRO:
IPR020625
MODBASE:
P0A6L2
PANTHER:
PTHR12128
PDB:
2OJP
PDB:
2PUR
PDB:
3C0J
PDB:
3DEN
PDB:
3DU0
PDB:
3I7R
PDB:
3I7S
PDB:
4EOU
PDB:
5T25
PDB:
5T26
PDB:
2ATS
PDB:
2A6N
PDB:
2A6L
PDB:
1YXD
PDB:
1YXC
PDB:
1S5W
PDB:
1S5V
PDB:
1S5T
PDB:
1DHP
PDB:
3I7Q
PFAM:
PF00701
PRIDE:
P0A6L2
PRINTS:
PR00146
PRODB:
PRO_000022400
PROSITE:
PS00665
PROSITE:
PS00666
REFSEQ:
NP_416973
SMART:
SM01130
SMR:
P0A6L2
UNIPROT:
P0A6L2


Operon      
Name: dapA-bamC         
Operon arrangement:
Transcription unit        Promoter
bamC
dapA-nlpB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2768 2598879 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2769 2599483 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2770 2599588 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2773 2600100 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2774 2600225 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Truffa-Bachi P., Patte JC., Cohen GN., 1967, [On the dihydrodipicolinate synthetase of Escherichia coli K12]., C R Acad Sci Hebd Seances Acad Sci D 265(13):928-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB