RegulonDB RegulonDB 10.8: Gene Form
   

dapE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapE yffB ypfN TSS_2765 TSS_2765 TSS_2764 TSS_2764 TSS_2763 TSS_2763 dapEp dapEp TSS_2762 TSS_2762 TSS_2761 TSS_2761

Gene      
Name: dapE    Texpresso search in the literature
Synonym(s): ECK2467, EG10208, b2472, msgB
Genome position(nucleotides): 2591607 --> 2592734 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.46
Reference(s): [1] Bouvier J., et al., 1992
External database links:  
ASAP:
ABE-0008142
CGSC:
876
ECHOBASE:
EB0204
ENTREZ:
X57403
MIM:
609924
OU-MICROARRAY:
b2472
PortEco:
dapE
STRING:
511145.b2472
COLOMBOS: dapE


Product      
Name: succinyl-diaminopimelate desuccinylase
Synonym(s): DapE, MsgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.269
Isoelectric point: 5.219
Motif(s):
 
Type Positions Sequence
175 -> 282 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRY
62 -> 371 AFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQLLARMYQRIME

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008237 - metallopeptidase activity
GO:0009014 - succinyl-diaminopimelate desuccinylase activity
GO:0042802 - identical protein binding
GO:0050897 - cobalt ion binding
biological_process GO:0006508 - proteolysis
GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0043093 - FtsZ-dependent cytokinesis
GO:0019877 - diaminopimelate biosynthetic process
Reference(s): [2] Kindler, et al., 1960
External database links:  
ECOCYC:
MONOMER0-1981
ECOLIWIKI:
b2472
INTERPRO:
IPR001261
INTERPRO:
IPR036264
INTERPRO:
IPR011650
INTERPRO:
IPR002933
INTERPRO:
IPR005941
MODBASE:
P0AED7
PFAM:
PF01546
PFAM:
PF07687
PRIDE:
P0AED7
PRODB:
PRO_000022403
PROSITE:
PS00758
PROSITE:
PS00759
REFSEQ:
NP_416967
SMR:
P0AED7
SWISSMODEL:
P0AED7
UNIPROT:
P0AED7


Operon      
Name: yffB-dapE-ypfN         
Operon arrangement:
Transcription unit        Promoter
dapE-ypfN
yffB-dapE-ypfN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2761 2591293 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2762 2591337 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2763 2592511 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2764 2592549 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2765 2592711 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bouvier J., Richaud C., Higgins W., Bogler O., Stragier P., 1992, Cloning, characterization, and expression of the dapE gene of Escherichia coli., J Bacteriol 174(16):5265-71

 [2] Kindler, S. H.., Gilvarg, C.., 1960, N-Succinyl-L-2,6-diaminopimelic acid deacylase., J Biol Chem 235:3532-5

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB