RegulonDB RegulonDB 10.8: Gene Form
   

dcm gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcm yedA yedJ vsr terminator TSS_2276 TSS_2276

Gene      
Name: dcm    Texpresso search in the literature
Synonym(s): ECK1959, EG10211, b1961, mec
Genome position(nucleotides): 2030899 <-- 2032317 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.15
External database links:  
ASAP:
ABE-0006509
CGSC:
874
ECHOBASE:
EB0207
MIM:
604121
MIM:
614116
OU-MICROARRAY:
b1961
PortEco:
dcm
STRING:
511145.b1961
COLOMBOS: dcm


Product      
Name: DNA-cytosine methyltransferase
Synonym(s): Dcm, Mec
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.465
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
87 -> 457 FRFIDLFAGIGGIRRGFESIGGQCVFTSEWNKHAVRTYKANHYCDPATHHFNEDIRDITLSHKEGVSDEAAAEHIRQHIPEHDVLLAGFPCQPFSLAGVSKKNSLGRAHGFACDTQGTLFFDVVRIIDARRPAMFVLENVKNLKSHDQGKTFRIIMQTLDELGYDVADAEDNGPDDPKIIDGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEILIDRGWDMATGEKDFDDPLNQQHRPRRLTPRECARLMGFEAPGEAKFRIPVSDTQAYRQFGNSVVVPVFAAVAKLLEPKIKQA
20 -> 75 MLEKLLQIYDVKTLVAQLNGVGENHWSAAILKRALANDSAWHRLSEKEFAHLQTLL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level --> 3.1.1.2 - methylation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0003886 - DNA (cytosine-5-)-methyltransferase activity
biological_process GO:0009307 - DNA restriction-modification system
GO:0032259 - methylation
GO:0090116 - C-5 methylation of cytosine
Note(s): Note(s): ...[more].
Reference(s): [1] Backman K. 1980
[2] Barbe J., et al., 1986
[3] Bhagwat AS., et al., 1987
[4] Bhagwat AS., et al., 1986
[5] Dreiseikelmann B., et al., 1981
[6] Gomez-Eichelmann MC., et al., 1985
[7] Hanck T., et al., 1989
[8] Hattman S., et al., 1973
[9] Hughes JA., et al., 1987
[10] Korba BE., et al., 1982
[11] Kruger DH., et al., 1985
[12] Lal D., et al., 1988
[13] Lee SY., et al., 1987
[14] Lieb M., et al., 1986
[15] Lundblad V., et al., 1985
[16] May MS., et al., 1975
[17] Pinney, et al., 1977
[18] Shenoy S., et al., 1987
[19] Szyf M., et al., 1984
[20] Szyf M., et al., 1982
External database links:  
DIP:
DIP-47858N
ECOCYC:
EG10211-MONOMER
ECOLIWIKI:
b1961
INTERPRO:
IPR018117
INTERPRO:
IPR040743
INTERPRO:
IPR031303
INTERPRO:
IPR029063
INTERPRO:
IPR001525
MINT:
MINT-1237420
MODBASE:
P0AED9
PANTHER:
PTHR10629
PFAM:
PF18284
PFAM:
PF00145
PRIDE:
P0AED9
PRINTS:
PR00105
PRODB:
PRO_000022407
PROSITE:
PS00094
PROSITE:
PS51679
PROSITE:
PS00095
REFSEQ:
NP_416470
SMR:
P0AED9
UNIPROT:
P0AED9


Operon      
Name: dcm-vsr         
Operon arrangement:
Transcription unit        Promoter
dcm-vsr


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2276 2031452 reverse nd [RS-EPT-CBR] [21]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Backman K., 1980, A cautionary note on the use of certain restriction endonucleases with methylated substrates., Gene 11(1-2):169-71

 [2] Barbe J., Gibert I., Guerrero R., 1986, 5-Azacytidine: survival and induction of the SOS response in Escherichia coli K-12., Mutat Res 166(1):9-16

 [3] Bhagwat AS., Roberts RJ., 1987, Genetic analysis of the 5-azacytidine sensitivity of Escherichia coli K-12., J Bacteriol 169(4):1537-46

 [4] Bhagwat AS., Sohail A., Roberts RJ., 1986, Cloning and characterization of the dcm locus of Escherichia coli K-12., J Bacteriol 166(3):751-5

 [5] Dreiseikelmann B., Wackernagel W., 1981, Absence in Bacillus subtilis and Staphylococcus aureus of the sequence-specific deoxyribonucleic acid methylation that is conferred in Escherichia coli K-12 by the dam and dcm enzymes., J Bacteriol 147(1):259-61

 [6] Gomez-Eichelmann MC., Alvarez G., 1985, Genetic expression and gyrase dependence of methylated and undermethylated DNA in Escherichia coli., Biochim Biophys Acta 825(3):335-8

 [7] Hanck T., Gerwin N., Fritz HJ., 1989, Nucleotide sequence of the dcm locus of Escherichia coli K12., Nucleic Acids Res 17(14):5844

 [8] Hattman S., Schlagman S., Cousens L., 1973, Isolation of a mutant of Escherichia coli defective in cytosine-specific deoxyribonucleic acid methylase activity and in partial protection of bacteriophage lambda against restriction by cells containing the N-3 drug-resistance factor., J Bacteriol 115(3):1103-7

 [9] Hughes JA., Brown LR., Ferro AJ., 1987, Expression of the cloned coliphage T3 S-adenosylmethionine hydrolase gene inhibits DNA methylation and polyamine biosynthesis in Escherichia coli., J Bacteriol 169(8):3625-32

 [10] Korba BE., Hays JB., 1982, Partially deficient methylation of cytosine in DNA at CCATGG sites stimulates genetic recombination of bacteriophage lambda., Cell 28(3):531-41

 [11] Kruger DH., Schroeder C., Reuter M., Bogdarina IG., Buryanov YI., Bickle TA., 1985, DNA methylation of bacterial viruses T3 and T7 by different DNA methylases in Escherichia coli K12 cells., Eur J Biochem 150(2):323-30

 [12] Lal D., Som S., Friedman S., 1988, Survival and mutagenic effects of 5-azacytidine in Escherichia coli., Mutat Res 193(3):229-36

 [13] Lee SY., Butler D., Kleckner N., 1987, Efficient Tn10 transposition into a DNA insertion hot spot in vivo requires the 5-methyl groups of symmetrically disposed thymines within the hot-spot consensus sequence., Proc Natl Acad Sci U S A 84(22):7876-80

 [14] Lieb M., Allen E., Read D., 1986, Very short patch mismatch repair in phage lambda: repair sites and length of repair tracts., Genetics 114(4):1041-60

 [15] Lundblad V., Kleckner N., 1985, Mismatch repair mutations of Escherichia coli K12 enhance transposon excision., Genetics 109(1):3-19

 [16] May MS., Hattaman S., 1975, Deoxyribonucleic acid-cytosine methylation by host- and plasmid-controlled enzymes., J Bacteriol 122(1):129-38

 [17] Pinney, R. J.., Tribe, M. J.., 1977, Resistance to acridines and thymineless death in a mec- mutant of Escherichia coli, J Pharm Pharmacol 29 Suppl:12P

 [18] Shenoy S., Ehrlich KC., Ehrlich M., 1987, Repair of thymine.guanine and uracil.guanine mismatched base-pairs in bacteriophage M13mp18 DNA heteroduplexes., J Mol Biol 197(4):617-26

 [19] Szyf M., Avraham-Haetzni K., Reifman A., Shlomai J., Kaplan F., Oppenheim A., Razin A., 1984, DNA methylation pattern is determined by the intracellular level of the methylase., Proc Natl Acad Sci U S A 81(11):3278-82

 [20] Szyf M., Gruenbaum Y., Urieli-Shoval S., Razin A., 1982, Studies on the biological role of DNA methylation: V. The pattern of E.coli DNA methylation., Nucleic Acids Res 10(22):7247-59

 [21] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB