RegulonDB RegulonDB 10.8: Gene Form
   

ddlA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddlA iraP yaiZ DksA-ppGpp DksA-ppGpp ppGpp terminator anti-terminator anti-anti-terminator TSS_495 TSS_495 iraPp2 iraPp2 iraPp1 iraPp1

Gene      
Name: ddlA    Texpresso search in the literature
Synonym(s): ECK0376, EG10213, b0381
Genome position(nucleotides): 399829 <-- 400923 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.05
External database links:  
ASAP:
ABE-0001309
CGSC:
30966
ECHOBASE:
EB0209
OU-MICROARRAY:
b0381
PortEco:
ddlA
STRING:
511145.b0381
COLOMBOS: ddlA


Product      
Name: D-alanine—D-alanine ligase A
Synonym(s): DdlA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.316
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
147 -> 348 LLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIE
5 -> 130 RVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVANLPFVGS
145 -> 348 KRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIE
175 -> 230 ESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008716 - D-alanine-D-alanine ligase activity
biological_process GO:0010165 - response to X-ray
GO:0009252 - peptidoglycan biosynthetic process
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47939N
ECOCYC:
DALADALALIGA-MONOMER
ECOLIWIKI:
b0381
INTERPRO:
IPR011127
INTERPRO:
IPR016185
INTERPRO:
IPR013815
INTERPRO:
IPR011761
INTERPRO:
IPR011095
INTERPRO:
IPR005905
INTERPRO:
IPR000291
MODBASE:
P0A6J8
PANTHER:
PTHR23132
PFAM:
PF01820
PFAM:
PF07478
PRIDE:
P0A6J8
PRODB:
PRO_000022419
PROSITE:
PS00844
PROSITE:
PS00843
PROSITE:
PS50975
REFSEQ:
NP_414915
SMR:
P0A6J8
UNIPROT:
P0A6J8


Operon      
Name: ddlA         
Operon arrangement:
Transcription unit        Promoter
ddlA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_495 401433 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB