RegulonDB RegulonDB 10.8: Gene Form
   

accD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

folC accD dedA dedD FadR anti-anti-terminator anti-terminator terminator accDp accDp TSS_2624 TSS_2624 TSS_2623 TSS_2623 TSS_2622 TSS_2622 TSS_2621 TSS_2621 dedDp3 dedDp3 dedDp2 dedDp2

Gene      
Name: accD    Texpresso search in the literature
Synonym(s): ECK2310, EG10217, b2316, dedB, usg
Genome position(nucleotides): 2433012 <-- 2433926 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.41
External database links:  
ASAP:
ABE-0007648
CGSC:
28570
ECHOBASE:
EB0213
MIM:
606054
OU-MICROARRAY:
b2316
PortEco:
accD
STRING:
511145.b2316
COLOMBOS: accD


Product      
Name: acetyl-CoA carboxyltransferase subunit β
Synonym(s): AccD, DedB, Usg
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.322
Isoelectric point: 7.79
Motif(s):
 
Type Positions Sequence
54 -> 265 RMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPE
225 -> 239 IGFAGPRVIEQTVRE
23 -> 292 VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGV
30 -> 30 C
49 -> 49 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0009317 - acetyl-CoA carboxylase complex
GO:0009329 - acetate CoA-transferase complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0003989 - acetyl-CoA carboxylase activity
GO:0016743 - carboxyl- or carbamoyltransferase activity
biological_process GO:0006417 - regulation of translation
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0017148 - negative regulation of translation
GO:0006633 - fatty acid biosynthetic process
GO:0042759 - long-chain fatty acid biosynthetic process
GO:2001295 - malonyl-CoA biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Nagano Y., et al., 1991
External database links:  
DIP:
DIP-35878N
ECOCYC:
CARBOXYL-TRANSFERASE-BETA-MONOMER
ECOLIWIKI:
b2316
INTERPRO:
IPR000438
INTERPRO:
IPR041010
INTERPRO:
IPR034733
INTERPRO:
IPR029045
INTERPRO:
IPR011762
MINT:
P0A9Q5
MODBASE:
P0A9Q5
PDB:
2F9Y
PFAM:
PF01039
PFAM:
PF17848
PRIDE:
P0A9Q5
PRINTS:
PR01070
PRODB:
PRO_000022035
PROSITE:
PS50980
REFSEQ:
NP_416819
SMR:
P0A9Q5
UNIPROT:
P0A9Q5


Operon      
Name: accD         
Operon arrangement:
Transcription unit        Promoter
accD


Transcriptional Regulation      
Display Regulation             
Activated by: FadR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dedDp2 2431868 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dedDp3 2431875 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2621 2433655 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2622 2433908 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2623 2433926 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2624 2433974 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nagano Y., Matsuno R., Sasaki Y., 1991, An essential gene of Escherichia coli that has sequence similarity to a chloroplast gene of unknown function., Mol Gen Genet 228(1-2):62-4

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB