RegulonDB RegulonDB 10.8: Gene Form
   

dedD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

folC accD dedD cvpA PurR anti-terminator terminator TSS_2623 TSS_2623 TSS_2622 TSS_2622 TSS_2621 TSS_2621 dedDp3 dedDp3 dedDp2 dedDp2 cvpAp1 cvpAp1 cvpAp2 cvpAp2

Gene      
Name: dedD    Texpresso search in the literature
Synonym(s): ECK2308, EG10218, b2314
Genome position(nucleotides): 2431022 <-- 2431684 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.01
External database links:  
ASAP:
ABE-0007643
ECHOBASE:
EB0214
OU-MICROARRAY:
b2314
PortEco:
dedD
STRING:
511145.b2314
COLOMBOS: dedD


Product      
Name: cell division protein DedD
Synonym(s): DedD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.938
Isoelectric point: 8.77
Motif(s):
 
Type Positions Sequence
138 -> 217 APTGKAYVVQLGALKNADKVNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMGY
141 -> 214 GKAYVVQLGALKNADKVNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVV
9 -> 29 LVGTIVLVALGVIVLPGLLDG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
GO:0030428 - cell septum
molecular_function GO:0042834 - peptidoglycan binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0032506 - cytokinetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Gerding MA., et al., 2009
External database links:  
ECOCYC:
EG10218-MONOMER
ECOLIWIKI:
b2314
INTERPRO:
IPR032898
INTERPRO:
IPR036680
INTERPRO:
IPR007730
PFAM:
PF05036
PRIDE:
P09549
PROSITE:
PS51724
REFSEQ:
NP_416817
SMR:
P09549
UNIPROT:
P09549


Operon      
Name: folC-dedD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dedDp2 2431868 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dedDp3 2431875 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2621 2433655 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2622 2433908 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2623 2433926 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gerding MA., Liu B., Bendezu FO., Hale CA., Bernhardt TG., de Boer PA., 2009, Self-enhanced accumulation of FtsN at Division Sites and Roles for Other Proteins with a SPOR domain (DamX, DedD, and RlpA) in Escherichia coli cell constriction., J Bacteriol 191(24):7383-401

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB