RegulonDB RegulonDB 10.6.3: Gene Form
   

deoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

deoA deoB deoC anti-terminator anti-anti-terminator TSS_5170 TSS_5170 TSS_5169 TSS_5169 TSS_5168 TSS_5168 TSS_5167 TSS_5167 TSS_5166 (cluster) TSS_5166 (cluster) deoBp deoBp TSS_5164 TSS_5164

Gene      
Name: deoA    Texpresso search in the literature
Synonym(s): ECK4374, EG10219, TP, b4382, tpp, ttg
Genome position(nucleotides): 4618229 --> 4619551 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.18
External database links:  
ASAP:
ABE-0014374
CGSC:
868
ECHOBASE:
EB0215
ECOCYC:
EG10219
ECOLIHUB:
deoA
MIM:
603041
OU-MICROARRAY:
b4382
REGULONDB:
b4382
STRING:
511145.b4382
M3D: deoA
COLOMBOS: deoA
PortEco: b4382


Product      
Name: thymidine phosphorylase
Synonym(s): DeoA, Tpp, Ttg
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.207
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
79 -> 309 GPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKLQAVLDNGKA
350 -> 423 FVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENNWQEAAKAVKAAIKL
6 -> 67 EIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0004645 - phosphorylase activity
GO:0016763 - transferase activity, transferring pentosyl groups
GO:0009032 - thymidine phosphorylase activity
GO:0016154 - pyrimidine-nucleoside phosphorylase activity
biological_process GO:0006206 - pyrimidine nucleobase metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0006213 - pyrimidine nucleoside metabolic process
GO:0046104 - thymidine metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Budman DR., et al., 1967
[2] Buxton RS. 1975
External database links:  
DIP:
DIP-9426N
ECOCYC:
DEOA-MONOMER
ECOLIWIKI:
b4382
INTERPRO:
IPR000312
INTERPRO:
IPR018090
INTERPRO:
IPR036566
INTERPRO:
IPR036320
INTERPRO:
IPR000053
INTERPRO:
IPR035902
INTERPRO:
IPR013102
INTERPRO:
IPR013465
INTERPRO:
IPR017459
INTERPRO:
IPR017872
MODBASE:
P07650
PANTHER:
PTHR10515
PDB:
4EAF
PDB:
4LHM
PDB:
4EAD
PDB:
2TPT
PDB:
1TPT
PDB:
1OTP
PDB:
1AZY
PFAM:
PF07831
PFAM:
PF02885
PFAM:
PF00591
PRIDE:
P07650
PROSITE:
PS00647
PROTEINMODELPORTAL:
P07650
REFSEQ:
NP_418799
SMART:
SM00941
SMR:
P07650
SWISSMODEL:
P07650
UNIPROT:
P07650


Operon      
Name: deoCABD         
Operon arrangement:
Transcription unit        Promoter
deoCABD
deoCABD
deoBD
deoA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fis
Repressed by: CRP, DeoR, ModE, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5164 4617361 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5166 (cluster) 4619576 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_5167 4619991 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5168 4620783 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5169 4620785 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5170 4620789 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Budman DR., Pardee AB., 1967, Thymidine and thymine incorporation into deoxyribonucleic acid: inhibition and repression by uridine of thymidine phosphorylase of Escherichia coli., J Bacteriol 94(5):1546-50

 [2] Buxton RS., 1975, Genetic analysis of thymidine-resistant and low-thymine-requiring mutants of Escherichia coli K-12 induced by bacteriophage Mu-1., J Bacteriol 121(2):475-84

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB