RegulonDB RegulonDB 10.7: Gene Form
   

deoR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacC deoR ybjG terminator TSS_989 TSS_989

Gene      
Name: deoR    Texpresso search in the literature
Synonym(s): ECK0830, EG10223, b0840, nucR
Genome position(nucleotides): 881976 <-- 882734 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.72
External database links:  
ASAP:
ABE-0002862
CGSC:
864
ECHOBASE:
EB0219
OU-MICROARRAY:
b0840
PORTECO:
deoR
REGULONDB:
b0840
STRING:
511145.b0840
M3D: deoR
COLOMBOS: deoR
PortEco: b0840


Product      
Name: DNA-binding transcriptional repressor DeoR
Synonym(s): DeoR, NucR, transcriptional repressor for deo operon, tsx, nupG
Sequence: Get amino acid sequence Fasta Format
Regulator Family: DeoR
Cellular location: cytosol
Molecular weight: 28.548
Isoelectric point: 7.775
Motif(s):
 
Type Positions Sequence
5 -> 57 REERIGQLLQELKRSDKLHLKDAAALLGVSEMTIRRDLNNHSAPVVLLGGYIV
22 -> 41 LHLKDAAALLGVSEMTIRRD
8 -> 59 RIGQLLQELKRSDKLHLKDAAALLGVSEMTIRRDLNNHSAPVVLLGGYIVLE
76 -> 232 VEEKRRAAKLAATLVEPDQTLFFDCGTTTPWIIEAIDNEIPFTAVCYSLNTFLALKEKPHCRAFLCGGEFHASNAIFKPIDFQQTLNNFCPDIAFYSAAGVHVSKGATCFNLEELPVKHWAMSMAQKHVLVVDHSKFGKVRPARMGDLKRFDIVVSD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:2000143 - negative regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Mortensen L., et al., 1989
[2] Valentin-Hansen P., et al., 1985
External database links:  
DIP:
DIP-9430N
ECOCYC:
PD01196
ECOLIWIKI:
b0840
INTERPRO:
IPR014036
INTERPRO:
IPR001034
INTERPRO:
IPR018356
INTERPRO:
IPR037171
MODBASE:
P0ACK5
PFAM:
PF08220
PFAM:
PF00455
PRIDE:
P0ACK5
PRODB:
PRO_000022431
PROSITE:
PS51000
PROSITE:
PS00894
PROTEINMODELPORTAL:
P0ACK5
REFSEQ:
NP_415361
SMART:
SM00420
SMR:
P0ACK5
UNIPROT:
P0ACK5


Operon      
Name: deoR         
Operon arrangement:
Transcription unit        Promoter
deoR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_989 882763 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Mortensen L., Dandanell G., Hammer K., 1989, Purification and characterization of the deoR repressor of Escherichia coli., EMBO J 8(1):325-31

 [2] Valentin-Hansen P., Hojrup P., Short S., 1985, The primary structure of the DeoR repressor from Escherichia coli K-12., Nucleic Acids Res 13(16):5927-36

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB