RegulonDB RegulonDB 10.6.3: Gene Form
   

dgkA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

plsB lexA dgkA LexA LexA LexA BasR anti-terminator terminator TSS_4882 TSS_4882 lexAp lexAp dgkAp dgkAp plsBp plsBp plsBp2 plsBp2 dgkAp1 dgkAp1 TSS_4879 TSS_4879 TSS_4878 TSS_4878 TSS_4877 TSS_4877

Gene      
Name: dgkA    Texpresso search in the literature
Synonym(s): ECK4034, EG10224, b4042
Genome position(nucleotides): 4256637 --> 4257005 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.76
External database links:  
ASAP:
ABE-0013235
CGSC:
862
ECHOBASE:
EB0220
ECOCYC:
EG10224
ECOLIHUB:
dgkA
OU-MICROARRAY:
b4042
REGULONDB:
b4042
STRING:
511145.b4042
M3D: dgkA
COLOMBOS: dgkA
PortEco: b4042


Product      
Name: diacylglycerol kinase
Synonym(s): DgkA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.245
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
16 -> 117 GYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILL
2 -> 122 ANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILLWSHFG
34 -> 49 QEGVAVLLAVVIACWL
53 -> 69 AITRVLLISSVMLVMIV
96 -> 119 DMGSAAVLIAIIVAVITWCILLWS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004143 - diacylglycerol kinase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006654 - phosphatidic acid biosynthetic process
GO:0008610 - lipid biosynthetic process
GO:0008654 - phospholipid biosynthetic process
GO:0016310 - phosphorylation
GO:0009411 - response to UV
External database links:  
DIP:
DIP-60228N
ECOCYC:
DIACYLGLYKIN-MONOMER
ECOLIWIKI:
b4042
INTERPRO:
IPR036945
INTERPRO:
IPR000829
INTERPRO:
IPR033718
PANTHER:
PTHR34299
PDB:
5D6I
PDB:
5DWK
PDB:
3ZE3
PDB:
4UYO
PDB:
4UXZ
PDB:
5D57
PDB:
2KDC
PDB:
5D56
PDB:
3ZE4
PDB:
3ZE5
PDB:
4BPD
PDB:
4BRB
PDB:
4BRR
PDB:
4CJZ
PDB:
4CK0
PDB:
4D2E
PDB:
4UP6
PDB:
4UXW
PDB:
4UXX
PFAM:
PF01219
PRIDE:
P0ABN1
PRODB:
PRO_000022432
PROSITE:
PS01069
PROTEINMODELPORTAL:
P0ABN1
REFSEQ:
NP_418466
SMR:
P0ABN1
UNIPROT:
P0ABN1


Operon      
Name: dgkA         
Operon arrangement:
Transcription unit        Promoter
dgkA
null


Transcriptional Regulation      
Display Regulation             
Activated by: BasR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4877 4255382 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4878 4255992 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4879 4256011 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4882 4257204 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB