RegulonDB RegulonDB 10.7: Gene Form
   

dicA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dicA dicC ydfA ydfX DicA terminator ydfAp6 ydfAp6 ydfAp8 ydfAp8 TSS_1868 TSS_1868 TSS_1867 (cluster) TSS_1867 (cluster) dicCp dicCp

Gene      
Name: dicA    Texpresso search in the literature
Synonym(s): ECK1564, EG10226, b1570, ftsT
Genome position(nucleotides): 1647934 --> 1648341 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.63
External database links:  
ASAP:
ABE-0005248
CGSC:
18427
ECHOBASE:
EB0222
OU-MICROARRAY:
b1570
PORTECO:
dicA
REGULONDB:
b1570
STRING:
511145.b1570
M3D: dicA
COLOMBOS: dicA
PortEco: b1570


Product      
Name: DNA-binding transcriptional dual regulator DicA
Synonym(s): DicA, FtsT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: cytosol
Molecular weight: 15.656
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
12 -> 66 IRYRRKNLKHTQRSLAKALKISHVSVSQWERGDSEPTGKNLFALSKVLQCSPTWI
23 -> 42 QRSLAKALKISHVSVSQWER

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0051301 - cell division
GO:0006351 - transcription, DNA-templated
GO:0007049 - cell cycle
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IFC] Inferred by functional complementation
Reference(s): [1] Aldea M., et al., 1988
[2] Cam K., et al., 1988
[3] Yun SH., et al., 2012
External database links:  
ECOCYC:
EG10226-MONOMER
ECOLIWIKI:
b1570
INTERPRO:
IPR001387
INTERPRO:
IPR010982
MODBASE:
P06966
PFAM:
PF01381
PRIDE:
P06966
PRODB:
PRO_000022443
PROSITE:
PS50943
PROTEINMODELPORTAL:
P06966
REFSEQ:
NP_416088
SMART:
SM00530
SMR:
P06966
SWISSMODEL:
P06966
UNIPROT:
P06966


Operon      
Name: dicA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1867 (cluster) 1647930 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1868 1647948 forward nd [RS-EPT-CBR] [4]
  promoter ydfAp6 1648457 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Aldea M., Hernandez-Chico C., de la Campa AG., Kushner SR., Vicente M., 1988, Identification, cloning, and expression of bolA, an ftsZ-dependent morphogene of Escherichia coli., J Bacteriol 170(11):5169-76

 [2] Cam K., Bejar S., Gil D., Bouche JP., 1988, Identification and sequence of gene dicB: translation of the division inhibitor from an in-phase internal start., Nucleic Acids Res 16(14A):6327-38

 [3] Yun SH., Ji SC., Jeon HJ., Wang X., Kim SW., Bak G., Lee Y., Lim HM., 2012, The CnuK9E H-NS complex antagonizes DNA binding of DicA and leads to temperature-dependent filamentous growth in E. coli., PLoS One 7(9):e45236

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB