RegulonDB RegulonDB 10.7: Gene Form
   

dicC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dicA ydfX dicC ydfW DicA terminator TSS_1868 TSS_1868 TSS_1867 (cluster) TSS_1867 (cluster) dicCp dicCp

Gene      
Name: dicC    Texpresso search in the literature
Synonym(s): ECK1563, EG10228, b1569, ftsT
Genome position(nucleotides): 1647620 <-- 1647850 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.75
External database links:  
ASAP:
ABE-0005244
CGSC:
18421
ECHOBASE:
EB0224
OU-MICROARRAY:
b1569
PORTECO:
dicC
REGULONDB:
b1569
STRING:
511145.b1569
M3D: dicC
COLOMBOS: dicC
PortEco: b1569


Product      
Name: Qin prophage; DNA-binding transcriptional regulator for DicB
Synonym(s): DicC, FtsT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.578
Isoelectric point: 9.97
Motif(s):
 
Type Positions Sequence
13 -> 33 KTKLAQAAGIRLASLYSWKGD
3 -> 59 KTDALLYFGSKTKLAQAAGIRLASLYSWKGDLVPEGRAMRLQEASGGELQYDPKVYD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
Note(s): Note(s): ...[more].
Reference(s): [1] Bejar S., et al., 1988
External database links:  
ECOCYC:
EG10228-MONOMER
ECOLIWIKI:
b1569
INTERPRO:
IPR010982
MODBASE:
P06965
PFAM:
PF14549
PRIDE:
P06965
PRODB:
PRO_000022445
PROTEINMODELPORTAL:
P06965
REFSEQ:
NP_416087
SMR:
P06965
UNIPROT:
P06965


Operon      
Name: dicC-ydfXW         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: DicA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1867 (cluster) 1647930 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1868 1647948 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bejar S., Bouche F., Bouche JP., 1988, Cell division inhibition gene dicB is regulated by a locus similar to lambdoid bacteriophage immunity loci., Mol Gen Genet 212(1):11-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB