RegulonDB RegulonDB 10.6.3: Gene Form
   

dnaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaA dnaN ysdD ArgP ArgP DnaA DnaA DnaA DnaA DnaA ArgP ppGpp ppGpp rpmHp3 rpmHp3 dnaAp1 dnaAp1 dnaAp2 dnaAp2 TSS_4270 TSS_4270 dnaNp1 dnaNp1 TSS_4269 TSS_4269 dnaNp2 dnaNp2 dnaNp3 dnaNp3 TSS_4268 TSS_4268 TSS_4267 TSS_4267 dnaNp4 dnaNp4 recFp2 recFp2 recFp1 recFp1

Gene      
Name: dnaA    Texpresso search in the literature
Synonym(s): ECK3694, EG10235, b3702
Genome position(nucleotides): 3882326 <-- 3883729 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.06
External database links:  
ASAP:
ABE-0012103
CGSC:
851
ECHOBASE:
EB0231
ECOCYC:
EG10235
ECOLIHUB:
dnaA
OU-MICROARRAY:
b3702
REGULONDB:
b3702
STRING:
511145.b3702
M3D: dnaA
COLOMBOS: dnaA
PortEco: b3702


Product      
Name: chromosomal replication initiator protein DnaA
Synonym(s): DnaA, chromosomal replication initiator protein/DNA-binding transcriptional dual regulator DnaA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: DnaA
Cellular location: inner membrane,cytosol
Molecular weight: 52.551
Isoelectric point: 8.96
Motif(s):
 
Type Positions Sequence
69 -> 70 AD
4 -> 64 SLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLT
172 -> 179 GGTGLGKT
133 -> 349 NVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANF
376 -> 444 IDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0009898 - cytoplasmic side of plasma membrane
GO:0044459 - plasma membrane part
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003688 - DNA replication origin binding
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
biological_process GO:0006260 - DNA replication
GO:0006270 - DNA replication initiation
GO:0006275 - regulation of DNA replication
GO:0008156 - negative regulation of DNA replication
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Chakraborty T., et al., 1982
[2] Fuller RS., et al., 1983
[3] Hansen EB., et al., 1982
[4] Hansen FG., et al., 1977
[5] Kubota T., et al., 1997
[6] Li Z., et al., 1999
[7] Miki T., et al., 1979
[8] Zhang Q., et al., 2016
External database links:  
DIP:
DIP-9455N
ECOCYC:
PD03831
ECOLIWIKI:
b3702
INTERPRO:
IPR020591
INTERPRO:
IPR038454
INTERPRO:
IPR027417
INTERPRO:
IPR024633
INTERPRO:
IPR018312
INTERPRO:
IPR013317
INTERPRO:
IPR013159
INTERPRO:
IPR010921
INTERPRO:
IPR003593
INTERPRO:
IPR001957
MINT:
MINT-207293
MODBASE:
P03004
PANTHER:
PTHR30050:SF2
PDB:
1J1V
PDB:
2E0G
PFAM:
PF11638
PFAM:
PF08299
PFAM:
PF00308
PRIDE:
P03004
PRINTS:
PR00051
PRODB:
PRO_000022459
PROSITE:
PS01008
PROTEINMODELPORTAL:
P03004
REFSEQ:
NP_418157
SMART:
SM00382
SMART:
SM00760
SMR:
P03004
SWISSMODEL:
P03004
UNIPROT:
P03004


Operon      
Name: dnaAN-recF         
Operon arrangement:
Transcription unit        Promoter
recF
recF
dnaN-recF
dnaN-recF
dnaN-recF
dnaN-recF
dnaAN-recF
dnaAN-recF


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP, DnaA
Repressed by: DnaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4267 3882351 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4268 3882359 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4269 3882731 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4270 3883878 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chakraborty T., Yoshinaga K., Lother H., Messer W., 1982, Purification of the E. coli dnaA gene product., EMBO J 1(12):1545-9

 [2] Fuller RS., Kornberg A., 1983, Purified dnaA protein in initiation of replication at the Escherichia coli chromosomal origin of replication., Proc Natl Acad Sci U S A 80(19):5817-21

 [3] Hansen EB., Hansen FG., von Meyenburg K., 1982, The nucleotide sequence of the dnaA gene and the first part of the dnaN gene of Escherichia coli K-12., Nucleic Acids Res 10(22):7373-85

 [4] Hansen FG., Rasmussen KV., 1977, Regulation of the dnaA product in Escherichia coli., Mol Gen Genet 155(2):219-25

 [5] Kubota T., Katayama T., Ito Y., Mizushima T., Sekimizu K., 1997, Conformational transition of DnaA protein by ATP: structural analysis of DnaA protein, the initiator of Escherichia coli chromosome replication., Biochem Biophys Res Commun 232(1):130-5

 [6] Li Z., Crooke E., 1999, Functional analysis of affinity-purified polyhistidine-tagged DnaA protein., Protein Expr Purif 17(1):41-8

 [7] Miki T., Kimura M., Hiraga S., Nagata T., Yura T., 1979, Cloning and physical mapping of the dnaA region of the Escherichia coli chromosome., J Bacteriol 140(3):817-24

 [8] Zhang Q., Zhou A., Ni J., Tao J., Lu J., Wan B., Li S., Zhang J., Zhao S., Zhao GP., Shao F., Yao YF., 2016, Reversible lysine acetylation is involved in DNA replication initiation by regulating activities of initiator DnaA in Escherichia coli., Sci Rep 6:30837

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB