RegulonDB RegulonDB 10.8: Gene Form
   

dnaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaE accA rnhB lpxB FadR TSS_390 TSS_390 TSS_389 TSS_389 TSS_388 TSS_388 accAp accAp accAp2 accAp2 TSS_386 TSS_386 TSS_385 TSS_385 TSS_384 TSS_384 TSS_383 TSS_383 TSS_382 TSS_382 TSS_381 TSS_381 TSS_380 TSS_380

Gene      
Name: dnaE    Texpresso search in the literature
Synonym(s): ECK0183, EG10238, b0184, polC, sdgC
Genome position(nucleotides): 205126 --> 208608 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.95
External database links:  
ASAP:
ABE-0000624
CGSC:
373
ECHOBASE:
EB0234
OU-MICROARRAY:
b0184
PortEco:
dnaE
STRING:
511145.b0184
COLOMBOS: dnaE


Product      
Name: DNA polymerase III subunit α
Synonym(s): DnaE, PolC, SdgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 129.904
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
920 -> 924 QADMF
921 -> 923 ADM
291 -> 558 YLVKRAKEGLEERLAFLFPDEEERLKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLG
561 -> 735 TLTIINWALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNG
808 -> 897 GLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0044776 - DNA polymerase III, core complex
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003824 - catalytic activity
GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
biological_process GO:0006260 - DNA replication
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Welch MM., et al., 1982
External database links:  
DIP:
DIP-9458N
ECOCYC:
EG10238-MONOMER
ECOLIWIKI:
b0184
INTERPRO:
IPR040982
INTERPRO:
IPR004013
INTERPRO:
IPR041931
INTERPRO:
IPR003141
INTERPRO:
IPR029460
INTERPRO:
IPR016195
INTERPRO:
IPR011708
INTERPRO:
IPR004805
INTERPRO:
IPR004365
MINT:
P10443
MODBASE:
P10443
PANTHER:
PTHR32294
PDB:
4GX9
PDB:
2HNH
PDB:
2HQA
PDB:
4GX8
PDB:
4JOM
PDB:
5M1S
PDB:
5FKW
PDB:
5FKV
PDB:
5FKU
PFAM:
PF01336
PFAM:
PF14579
PFAM:
PF07733
PFAM:
PF02811
PFAM:
PF17657
PRIDE:
P10443
PRODB:
PRO_000022462
REFSEQ:
NP_414726
SMART:
SM00481
SMR:
P10443
UNIPROT:
P10443


Operon      
Name: bamA-skp-lpxD-fabZ-lpxAB-rnhB-dnaE         
Operon arrangement:
Transcription unit        Promoter
bamA-hlpA-lpxD-fabZ-lpxAB-rnhB-dnaE
bamA
hlpA-lpxD-fabZ-lpxA
lpxD
fabZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_380 204501 forward nd [RS-EPT-CBR] [2]
  promoter TSS_381 204507 forward nd [RS-EPT-CBR] [2]
  promoter TSS_382 206909 forward nd [RS-EPT-CBR] [2]
  promoter TSS_383 207634 forward nd [RS-EPT-CBR] [2]
  promoter TSS_384 207925 forward nd [RS-EPT-CBR] [2]
  promoter TSS_385 208042 forward nd [RS-EPT-CBR] [2]
  promoter TSS_386 208276 forward nd [RS-EPT-CBR] [2]
  promoter TSS_388 208850 forward nd [RS-EPT-CBR] [2]
  promoter TSS_389 209002 forward nd [RS-EPT-CBR] [2]
  promoter TSS_390 209273 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Welch MM., McHenry CS., 1982, Cloning and identification of the product of the dnaE gene of Escherichia coli., J Bacteriol 152(1):351-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB