RegulonDB RegulonDB 10.7: Gene Form
   

dnaJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaK dnaJ insL-1 unknown tpke11 terminator TSS_40 TSS_40 TSS_39 TSS_39 insLp6 insLp6 insLp5 insLp5 TSS_38 TSS_38 TSS_37 TSS_37 TSS_36 TSS_36 TSS_35 (cluster) TSS_35 (cluster) TSS_34 TSS_34 TSS_33 TSS_33 TSS_32 (cluster) TSS_32 (cluster) TSS_31 (cluster) TSS_31 (cluster) TSS_30 TSS_30 TSS_29 TSS_29 TSS_28 TSS_28

Gene      
Name: dnaJ    Texpresso search in the literature
Synonym(s): ECK0015, EG10240, b0015, groP, grpC
Genome position(nucleotides): 14168 --> 15298 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.17
Reference(s): [1] Ohki M., et al., 1986
[2] Saito H., et al., 1978
[3] Yochem J., et al., 1978
External database links:  
ASAP:
ABE-0000054
CGSC:
845
ECHOBASE:
EB0236
OU-MICROARRAY:
b0015
PORTECO:
dnaJ
REGULONDB:
b0015
STRING:
511145.b0015
M3D: dnaJ
COLOMBOS: dnaJ
PortEco: b0015


Product      
Name: chaperone protein DnaJ
Synonym(s): DnaJ, DnaK co-chaperone Hsp40, GroP, GrpC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 41.1
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
3 -> 72 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA
26 -> 26 K
34 -> 34 P
46 -> 46 K
58 -> 59 TD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0032991 - protein-containing complex
molecular_function GO:0003756 - protein disulfide isomerase activity
GO:0005515 - protein binding
GO:0016989 - sigma factor antagonist activity
GO:0046872 - metal ion binding
GO:0051082 - unfolded protein binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0015035 - protein disulfide oxidoreductase activity
GO:0031072 - heat shock protein binding
GO:0042803 - protein homodimerization activity
GO:0051087 - chaperone binding
biological_process GO:0006260 - DNA replication
GO:0006457 - protein folding
GO:0009408 - response to heat
GO:0042026 - protein refolding
GO:0016032 - viral process
GO:0065003 - protein-containing complex assembly
GO:0051085 - chaperone cofactor-dependent protein refolding
GO:0055114 - oxidation-reduction process
GO:0043335 - protein unfolding
GO:1903507 - negative regulation of nucleic acid-templated transcription
External database links:  
DIP:
DIP-9460N
ECOCYC:
EG10240-MONOMER
ECOLIWIKI:
b0015
INTERPRO:
IPR008971
INTERPRO:
IPR018253
INTERPRO:
IPR001623
INTERPRO:
IPR002939
INTERPRO:
IPR012724
INTERPRO:
IPR036869
INTERPRO:
IPR036410
INTERPRO:
IPR001305
MINT:
P08622
MODBASE:
P08622
PDB:
5NRO
PDB:
1XBL
PDB:
1EXK
PDB:
1BQZ
PDB:
1BQ0
PFAM:
PF00226
PFAM:
PF01556
PFAM:
PF00684
PRIDE:
P08622
PRINTS:
PR00625
PRODB:
PRO_000022464
PROSITE:
PS51188
PROSITE:
PS00636
PROSITE:
PS50076
PROTEINMODELPORTAL:
P08622
REFSEQ:
NP_414556
SMART:
SM00271
SMR:
P08622
UNIPROT:
P08622


Operon      
Name: dnaK-tpke11-dnaJ         
Operon arrangement:
Transcription unit        Promoter
dnaKJ
dnaKJ
dnaKJ
tpke11


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_28 12891 forward nd [RS-EPT-CBR] [4]
  promoter TSS_29 13044 forward nd [RS-EPT-CBR] [4]
  promoter TSS_30 13046 forward nd [RS-EPT-CBR] [4]
  promoter TSS_31 (cluster) 13048 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_32 (cluster) 13052 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_33 13058 forward nd [RS-EPT-CBR] [4]
  promoter TSS_34 13064 forward nd [RS-EPT-CBR] [4]
  promoter TSS_35 (cluster) 13082 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_36 13111 forward nd [RS-EPT-CBR] [4]
  promoter TSS_37 13127 forward nd [RS-EPT-CBR] [4]
  promoter TSS_38 13129 forward nd [RS-EPT-CBR] [4]
  promoter insLp5 15380 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter insLp6 15436 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_39 15463 forward nd [RS-EPT-CBR] [4]
  promoter TSS_40 15553 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ohki M., Tamura F., Nishimura S., Uchida H., 1986, Nucleotide sequence of the Escherichia coli dnaJ gene and purification of the gene product., J Biol Chem 261(4):1778-81

 [2] Saito H., Uchida H., 1978, Organization and expression of the dnaJ and dnaK genes of Escherichia coli K12., Mol Gen Genet 164(1):1-8

 [3] Yochem J., Uchida H., Sunshine M., Saito H., Georgopoulos CP., Feiss M., 1978, Genetic analysis of two genes, dnaJ and dnaK, necessary for Escherichia coli and bacteriophage lambda DNA replication., Mol Gen Genet 164(1):9-14

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB