RegulonDB RegulonDB 10.8: Gene Form
   

dnaQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaQ rnhA aspV yafS Fis TSS_435 TSS_435 aspVp aspVp rnhAp rnhAp TSS_433 TSS_433 TSS_432 (cluster) TSS_432 (cluster) dnaQp2 dnaQp2 TSS_431 TSS_431 dnaQp1 dnaQp1

Gene      
Name: dnaQ    Texpresso search in the literature
Synonym(s): ECK0215, EG10243, b0215, mutD
Genome position(nucleotides): 236067 --> 236798 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.14
External database links:  
ASAP:
ABE-0000722
CGSC:
840
ECHOBASE:
EB0239
OU-MICROARRAY:
b0215
PortEco:
dnaQ
STRING:
511145.b0215
COLOMBOS: dnaQ


Product      
Name: DNA polymerase III subunit ε
Synonym(s): DnaQ, MutD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.099
Isoelectric point: 5.626
Motif(s):
 
Type Positions Sequence
9 -> 175 IVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVY
183 -> 187 TSMAF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0044776 - DNA polymerase III, core complex
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008408 - 3'-5' exonuclease activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
biological_process GO:0006260 - DNA replication
GO:0045004 - DNA replication proofreading
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] DiFrancesco R., et al., 1984
[2] Scheuermann R., et al., 1983
External database links:  
DIP:
DIP-9462N
ECOCYC:
EG10243-MONOMER
ECOLIWIKI:
b0215
INTERPRO:
IPR006054
INTERPRO:
IPR036397
INTERPRO:
IPR013520
INTERPRO:
IPR006309
INTERPRO:
IPR012337
MINT:
P03007
MODBASE:
P03007
PANTHER:
PTHR30231:SF0
PDB:
5FKV
PDB:
5FKW
PDB:
5M1S
PDB:
5FKU
PDB:
4GX9
PDB:
2XY8
PDB:
2IDO
PDB:
2GUI
PDB:
1MGZ
PDB:
1J54
PDB:
1J53
PDB:
4GX8
PFAM:
PF00929
PRIDE:
P03007
PRODB:
PRO_000022467
REFSEQ:
NP_414751
SMART:
SM00479
SMR:
P03007
UNIPROT:
P03007


Operon      
Name: dnaQ         
Operon arrangement:
Transcription unit        Promoter
dnaQ
dnaQ
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_431 235937 forward nd [RS-EPT-CBR] [3]
  promoter TSS_432 (cluster) 236020 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_433 236027 forward nd [RS-EPT-CBR] [3]
  promoter TSS_435 236931 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] DiFrancesco R., Bhatnagar SK., Brown A., Bessman MJ., 1984, The interaction of DNA polymerase III and the product of the Escherichia coli mutator gene, mutD., J Biol Chem 259(9):5567-73

 [2] Scheuermann R., Tam S., Burgers PM., Lu C., Echols H., 1983, Identification of the epsilon-subunit of Escherichia coli DNA polymerase III holoenzyme as the dnaQ gene product: a fidelity subunit for DNA replication., Proc Natl Acad Sci U S A 80(23):7085-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB