RegulonDB RegulonDB 10.8: Gene Form
   

mltD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltD gloB yafE mltDp3 mltDp3 mltDp4 mltDp4 TSS_429 TSS_429

Gene      
Name: mltD    Texpresso search in the literature
Synonym(s): ECK0211, EG10246, b0211, dniR, yafG
Genome position(nucleotides): 232597 <-- 233955 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.95
External database links:  
ASAP:
ABE-0000704
CGSC:
30876
ECHOBASE:
EB0242
OU-MICROARRAY:
b0211
PortEco:
mltD
STRING:
511145.b0211
COLOMBOS: mltD


Product      
Name: membrane-bound lytic murein transglycosylase D
Synonym(s): DniR, MltD, YafG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,inner membrane
Molecular weight: 49.417
Isoelectric point: 10.496
Motif(s):
 
Type Positions Sequence
16 -> 452 CQSTGNVQQHAQSLSAAGQGEAAKFTSQARWMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDARRDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLPLPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGISVSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNSRVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNNMPDS
69 -> 72 MGIP
402 -> 442 YRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTL
102 -> 216 MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDARRDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKST
113 -> 198 NMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDARRDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0036405 - anchored component of cell outer membrane
molecular_function GO:0016829 - lyase activity
GO:0008933 - lytic transglycosylase activity
GO:0008932 - lytic endotransglycosylase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0051301 - cell division
GO:0071555 - cell wall organization
GO:0051353 - positive regulation of oxidoreductase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Bateman A., et al., 2000
[2] Blackburn NT., et al., 2001
[3] Kajie S., et al., 1991
[4] Koonin EV., et al., 1994
External database links:  
DIP:
DIP-48010N
ECOCYC:
EG10246-MONOMER
ECOLIWIKI:
b0211
INTERPRO:
IPR008258
INTERPRO:
IPR036779
INTERPRO:
IPR023346
INTERPRO:
IPR018392
INTERPRO:
IPR000189
MODBASE:
P0AEZ7
PDB:
1E0G
PFAM:
PF01464
PFAM:
PF01476
PRIDE:
P0AEZ7
PRODB:
PRO_000023248
PROSITE:
PS00922
PROSITE:
PS51782
PROSITE:
PS51257
REFSEQ:
NP_414747
SMART:
SM00257
SMR:
P0AEZ7
SWISSMODEL:
P0AEZ7
UNIPROT:
P0AEZ7


Operon      
Name: mltD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_429 233980 reverse nd [RS-EPT-CBR] [5]
  promoter mltDp4 233982 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter mltDp3 234025 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bateman A., Bycroft M., 2000, The structure of a LysM domain from E. coli membrane-bound lytic murein transglycosylase D (MltD)., J Mol Biol 299(4):1113-9

 [2] Blackburn NT., Clarke AJ., 2001, Identification of four families of peptidoglycan lytic transglycosylases., J Mol Evol 52(1):78-84

 [3] Kajie S., Ideta R., Yamato I., Anraku Y., 1991, Molecular cloning and DNA sequence of dniR, a gene affecting anaerobic expression of the Escherichia coli hexaheme nitrite reductase., FEMS Microbiol Lett 67(2):205-11

 [4] Koonin EV., Rudd KE., 1994, A conserved domain in putative bacterial and bacteriophage transglycosylases., Trends Biochem Sci 19(3):106-7

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB