RegulonDB RegulonDB 10.8: Gene Form
   

acpS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdxJ recO acpS ohsC TSS_2857 TSS_2857 TSS_2856 TSS_2856 pdxJp pdxJp acpSp3 acpSp3 acpSp2 acpSp2

Gene      
Name: acpS    Texpresso search in the literature
Synonym(s): ECK2561, EG10247, b2563, dpj
Genome position(nucleotides): 2700618 <-- 2700998 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.44
External database links:  
ASAP:
ABE-0008433
ECHOBASE:
EB0243
OU-MICROARRAY:
b2563
PortEco:
acpS
STRING:
511145.b2563
COLOMBOS: acpS


Product      
Name: holo-[acyl-carrier-protein] synthase
Synonym(s): AcpS, AcpSholo, Dpj
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.052
Isoelectric point: 9.853
Motif(s):
 
Type Positions Sequence
2 -> 126 AILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACATVIIES
5 -> 121 GLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACAT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008897 - holo-[acyl-carrier-protein] synthase activity
GO:0000287 - magnesium ion binding
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
GO:0018070 - peptidyl-serine phosphopantetheinylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9047N
ECOCYC:
HOLO-ACP-SYNTH-MONOMER
ECOLIWIKI:
b2563
INTERPRO:
IPR002582
INTERPRO:
IPR037143
INTERPRO:
IPR008278
INTERPRO:
IPR004568
MINT:
MINT-1256571
MODBASE:
P24224
PANTHER:
PTHR45198
PDB:
5VBX
PDB:
5XU7
PDB:
5XUH
PDB:
5VCB
PFAM:
PF01648
PRIDE:
P24224
PRODB:
PRO_000022046
PRODOM:
PD004282
REFSEQ:
NP_417058
SMR:
P24224
UNIPROT:
P24224


Operon      
Name: rnc-era-recO-pdxJ-acpS         
Operon arrangement:
Transcription unit        Promoter
pdxJ-acpS
rnc-era
rnc-era-recO-pdxJ-acpS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter acpSp2 2701137 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter acpSp3 2701162 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2856 2702292 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2857 2702302 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB