RegulonDB RegulonDB 10.9: Gene Form
   

dut gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dfp yicR slmA dut DksA-ppGpp DksA-ppGpp terminator anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator dutp dutp dfpp dfpp yicRp yicRp rpmBp rpmBp

Gene      
Name: dut    Texpresso search in the literature
Synonym(s): ECK3630, EG10251, b3640, dnaS, sof
Genome position(nucleotides): 3813929 --> 3814387 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.47
External database links:  
ASAP:
ABE-0011899
CGSC:
832
ECHOBASE:
EB0247
ECOLIHUB:
dut
OU-MICROARRAY:
b3640
STRING:
511145.b3640
COLOMBOS: dut


Product      
Name: dUTP diphosphatase
Synonym(s): DnaS, Dut, Sof
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.287
Isoelectric point: 4.863
Motif(s):
 
Type Positions Sequence
142 -> 152 GEGGFGHSGRQ
17 -> 150 EFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSG
71 -> 73 RSG
90 -> 90 D
88 -> 90 LID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004170 - dUTP diphosphatase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0009117 - nucleotide metabolic process
GO:0006220 - pyrimidine nucleotide metabolic process
GO:0006226 - dUMP biosynthetic process
GO:0070207 - protein homotrimerization
GO:0046081 - dUTP catabolic process
External database links:  
DISPROT:
DP00337
ECOCYC:
DUTP-PYROP-MONOMER
ECOLIWIKI:
b3640
INTERPRO:
IPR033704
INTERPRO:
IPR029054
INTERPRO:
IPR008181
INTERPRO:
IPR036157
MODBASE:
P06968
PANTHER:
PTHR11241
PDB:
6HDE
PDB:
2HRM
PDB:
2HR6
PDB:
1SYL
PDB:
1SEH
PDB:
1RNJ
PDB:
1RN8
PDB:
1EUW
PDB:
1EU5
PDB:
1DUP
PDB:
1DUD
PFAM:
PF00692
PRIDE:
P06968
PRODB:
PRO_000022493
REFSEQ:
NP_418097
SMR:
P06968
UNIPROT:
P06968


Operon      
Name: dut-slmA         
Operon arrangement:
Transcription unit        Promoter
dut-slmA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB