RegulonDB RegulonDB 10.6.3: Gene Form
   

ebgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ebgA ygjI ebgR ebgC ygjIp1 ygjIp1 ygjIp2 ygjIp2 ebgAp ebgAp

Gene      
Name: ebgA    Texpresso search in the literature
Synonym(s): ECK3066, EG10252, b3076
Genome position(nucleotides): 3222633 --> 3225725 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.54
External database links:  
ASAP:
ABE-0010104
CGSC:
830
ECHOBASE:
EB0248
ECOCYC:
EG10252
ECOLIHUB:
ebgA
OU-MICROARRAY:
b3076
REGULONDB:
b3076
STRING:
511145.b3076
M3D: ebgA
COLOMBOS: ebgA
PortEco: b3076


Product      
Name: evolved β-D-galactosidase subunit α
Synonym(s): EbgA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 117.879
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
1026 -> 1026 S
614 -> 699 LKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHPIATYQFPL
767 -> 767 M
44 -> 204 LSGQWNFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQWADSTYVEDQDMWWSAGIFRDVYLV
640 -> 640 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0009341 - beta-galactosidase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004565 - beta-galactosidase activity
GO:0030246 - carbohydrate binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0005990 - lactose catabolic process
External database links:  
CAZY:
GH2
DIP:
DIP-2893N
ECOCYC:
EG10252-MONOMER
ECOLIWIKI:
b3076
INTERPRO:
IPR017853
INTERPRO:
IPR036156
INTERPRO:
IPR032312
INTERPRO:
IPR023232
INTERPRO:
IPR023230
INTERPRO:
IPR014718
INTERPRO:
IPR013783
INTERPRO:
IPR011013
INTERPRO:
IPR008979
INTERPRO:
IPR006104
INTERPRO:
IPR006103
INTERPRO:
IPR006102
INTERPRO:
IPR006101
INTERPRO:
IPR004199
MODBASE:
P06864
PFAM:
PF02929
PFAM:
PF00703
PFAM:
PF02836
PFAM:
PF02837
PFAM:
PF16353
PRIDE:
P06864
PRINTS:
PR00132
PRODB:
PRO_000022497
PROSITE:
PS00608
PROSITE:
PS00719
PROTEINMODELPORTAL:
P06864
REFSEQ:
YP_026199
SMART:
SM01038
SMR:
P06864
UNIPROT:
P06864


Operon      
Name: ebgAC         
Operon arrangement:
Transcription unit        Promoter
ebgAC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: EbgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygjIp2 3226070 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjIp1 3226142 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB