RegulonDB RegulonDB 10.6.3: Gene Form
   

ebgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ebgA ygjI ebgR ebgC ygjIp1 ygjIp1 ygjIp2 ygjIp2 ebgAp ebgAp

Gene      
Name: ebgC    Texpresso search in the literature
Synonym(s): ECK3067, EG10253, b3077
Genome position(nucleotides): 3225722 --> 3226171 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.56
External database links:  
ASAP:
ABE-0010106
CGSC:
18412
ECHOBASE:
EB0249
ECOCYC:
EG10253
ECOLIHUB:
ebgC
OU-MICROARRAY:
b3077
REGULONDB:
b3077
STRING:
511145.b3077
M3D: ebgC
COLOMBOS: ebgC
PortEco: b3077


Product      
Name: DUF386 domain-containing evolved β-D-galactosidase subunit β
Synonym(s): EbgC, evolved beta;-D-galactosidase subunit beta;
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.457
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
144 -> 149 GYFHNK
3 -> 140 IIDNLEQFRQIYASGKKWQRCVEAIENIDNIQPGVAHSIGDSLTYRVETDSATDALFTGHRRYFEVHYYLQGQQKIEYAPKETLQVVEYYRDETDREYLKGCGETVEVHEGQIVICDIHEAYRFICNNAVKKVVLKVT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
External database links:  
DIP:
DIP-2894N
ECOCYC:
EG10253-MONOMER
ECOLIWIKI:
b3077
INTERPRO:
IPR004375
INTERPRO:
IPR037012
MODBASE:
P0AC73
PANTHER:
PTHR34986
PFAM:
PF04074
PRIDE:
P0AC73
PRODB:
PRO_000022498
PROTEINMODELPORTAL:
P0AC73
REFSEQ:
NP_417548
SMR:
P0AC73
UNIPROT:
P0AC73


Operon      
Name: ebgAC         
Operon arrangement:
Transcription unit        Promoter
ebgAC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: EbgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygjIp2 3226070 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjIp1 3226142 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB