RegulonDB RegulonDB 10.6.3: Gene Form
   

ebgR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ebgA ebgR ygjH ebgC ebgAp ebgAp ebgRp ebgRp ygjHp4 ygjHp4 ygjHp3 ygjHp3

Gene      
Name: ebgR    Texpresso search in the literature
Synonym(s): ECK3065, EG10254, b3075
Genome position(nucleotides): 3221466 --> 3222449 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0010099
CGSC:
829
ECHOBASE:
EB0250
ECOCYC:
EG10254
ECOLIHUB:
ebgR
OU-MICROARRAY:
b3075
REGULONDB:
b3075
STRING:
511145.b3075
M3D: ebgR
COLOMBOS: ebgR
PortEco: b3075


Product      
Name: DNA-binding transcriptional repressor EbgR
Synonym(s): EbgR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 36.21
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
195 -> 195 A
3 -> 49 TLKDIAIEAGVSLATVSRVLNDDPTLNVKEETKHRILEIAEKLEYKT
1 -> 57 MATLKDIAIEAGVSLATVSRVLNDDPTLNVKEETKHRILEIAEKLEYKTSSARKLQT
190 -> 190 D
196 -> 196 F

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9488N
ECOCYC:
PD03254
ECOLIWIKI:
b3075
INTERPRO:
IPR028082
INTERPRO:
IPR000843
INTERPRO:
IPR010982
MODBASE:
P06846
PFAM:
PF00356
PRIDE:
P06846
PRINTS:
PR00036
PRODB:
PRO_000022499
PROSITE:
PS00356
PROSITE:
PS50932
PROTEINMODELPORTAL:
P06846
REFSEQ:
NP_417546
SMART:
SM00354
SMR:
P06846
UNIPROT:
P06846


Operon      
Name: ebgR         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygjHp3 3221255 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjHp4 3221264 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB