RegulonDB RegulonDB 10.8: Gene Form
   

entB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entE entB entA entH entHp entHp

Gene      
Name: entB    Texpresso search in the literature
Synonym(s): ECK0588, EG10260, b0595, entG
Genome position(nucleotides): 627694 --> 628551 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.36
External database links:  
ASAP:
ABE-0002052
CGSC:
821
ECHOBASE:
EB0256
OU-MICROARRAY:
b0595
PortEco:
entB
STRING:
511145.b0595
COLOMBOS: entB


Product      
Name: enterobactin synthase component B
Synonym(s): EntB, EntG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 32.554
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
242 -> 242 G
263 -> 263 D
264 -> 264 F
249 -> 249 M
209 -> 284 APIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  2 - information transfer --> 2.3 - protein related --> 2.3.9 - Non-ribosomal peptide synthetase
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0008908 - isochorismatase activity
GO:0000287 - magnesium ion binding
GO:0031177 - phosphopantetheine binding
GO:0042802 - identical protein binding
GO:0047527 - 2,3-dihydroxybenzoate-serine ligase activity
biological_process GO:0008152 - metabolic process
GO:0009239 - enterobactin biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Chen D., et al., 2009
[2] Gehring AM., et al., 1998
[3] Hubrich F., et al., 2013
[4] Khalil S., et al., 2009
[5] Woodrow GC., et al., 1975
[6] Zhou Z., et al., 2007
External database links:  
DIP:
DIP-9512N
ECOCYC:
ENTB-MONOMER
ECOLIWIKI:
b0595
INTERPRO:
IPR036736
INTERPRO:
IPR036380
INTERPRO:
IPR000868
INTERPRO:
IPR016291
INTERPRO:
IPR009081
MINT:
MINT-1241343
MODBASE:
P0ADI4
PANTHER:
PTHR43540:SF3
PDB:
3RG2
PDB:
2FQ1
PDB:
4IZ6
PFAM:
PF00857
PFAM:
PF00550
PRIDE:
P0ADI4
PRINTS:
PR01398
PRODB:
PRO_000022520
PROSITE:
PS50075
REFSEQ:
NP_415127
SMR:
P0ADI4
SWISSMODEL:
P0ADI4
UNIPROT:
P0ADI4


Operon      
Name: entCEBAH         
Operon arrangement:
Transcription unit        Promoter
entCEBA-ybdB
entH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chen D., Wu R., Bryan TL., Dunaway-Mariano D., 2009, In vitro kinetic analysis of substrate specificity in enterobactin biosynthetic lower pathway enzymes provides insight into the biochemical function of the hot dog-fold thioesterase EntH., Biochemistry 48(3):511-3

 [2] Gehring AM., Mori I., Walsh CT., 1998, Reconstitution and characterization of the Escherichia coli enterobactin synthetase from EntB, EntE, and EntF., Biochemistry 37(8):2648-59

 [3] Hubrich F., Mordhorst S., Andexer JN., 2013, Cinnamic acid derivatives as inhibitors for chorismatases and isochorismatases., Bioorg Med Chem Lett 23(5):1477-81

 [4] Khalil S., Pawelek PD., 2009, Ligand-induced conformational rearrangements promote interaction between the Escherichia coli enterobactin biosynthetic proteins EntE and EntB., J Mol Biol 393(3):658-71

 [5] Woodrow GC., Young IG., Gibson F., 1975, Mu-induced polarity in the Escherichia coli K-12 ent gene cluster: evidence for a gene (entG) involved in the biosynthesis of enterochelin., J Bacteriol 124(1):1-6

 [6] Zhou Z., Lai JR., Walsh CT., 2007, Directed evolution of aryl carrier proteins in the enterobactin synthetase., Proc Natl Acad Sci U S A 104(28):11621-6


RegulonDB