RegulonDB RegulonDB 10.8: Gene Form
   

entE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entE entC entB Fur

Gene      
Name: entE    Texpresso search in the literature
Synonym(s): ECK0587, EG10263, b0594
Genome position(nucleotides): 626070 --> 627680 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.05
External database links:  
ASAP:
ABE-0002049
CGSC:
818
ECHOBASE:
EB0259
OU-MICROARRAY:
b0594
PortEco:
entE
STRING:
511145.b0594
COLOMBOS: entE


Product      
Name: 2,3-dihydroxybenzoate-AMP ligase
Synonym(s): EntE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 59.112
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
37 -> 437 SDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINR
473 -> 473 K
438 -> 439 GG
369 -> 378 DAEGNPLPQG
446 -> 520 EIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016874 - ligase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008668 - (2,3-dihydroxybenzoyl)adenylate synthase activity
GO:0047527 - 2,3-dihydroxybenzoate-serine ligase activity
biological_process GO:0009239 - enterobactin biosynthetic process
GO:0019290 - siderophore biosynthetic process
External database links:  
DIP:
DIP-9515N
ECOCYC:
ENTE-MONOMER
ECOLIWIKI:
b0594
INTERPRO:
IPR025110
INTERPRO:
IPR042099
INTERPRO:
IPR020845
INTERPRO:
IPR011963
INTERPRO:
IPR000873
MINT:
MINT-1228110
MODBASE:
P10378
PDB:
6IYL
PDB:
6IYK
PDB:
4IZ6
PDB:
3RG2
PFAM:
PF00501
PFAM:
PF13193
PRIDE:
P10378
PRODB:
PRO_000022523
PROSITE:
PS00455
REFSEQ:
NP_415126
SMR:
P10378
SWISSMODEL:
P10378
UNIPROT:
P10378


Operon      
Name: entCEBAH         
Operon arrangement:
Transcription unit        Promoter
entCEBA-ybdB
entH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB