RegulonDB RegulonDB 10.6.3: Gene Form
   

entF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entF fes fepE ybdZ fepC

Gene      
Name: entF    Texpresso search in the literature
Synonym(s): ECK0579, EG10264, b0586
Genome position(nucleotides): 614157 --> 618038 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.54
External database links:  
ASAP:
ABE-0002021
CGSC:
817
ECHOBASE:
EB0260
ECOCYC:
EG10264
ECOLIHUB:
entF
OU-MICROARRAY:
b0586
REGULONDB:
b0586
STRING:
511145.b0586
M3D: entF
COLOMBOS: entF
PortEco: b0586


Product      
Name: apo-serine activating enzyme
Synonym(s): EntF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 141.99
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
1067 -> 1283 TLFCFHPASGFAWQFSVLSRYLDPQWSIIGIQSPRPNGPMQTAANLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAFLGLLDTWPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELFTTIEGNYADAVRLLTTAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIAELDIYRQDCAHVDIISPGTFEKI
1138 -> 1138 S
971 -> 1046 APKAGSETIIAAAFSSLLGCDVQDADADFFALGGHSLLAMKLAAQLSRQVARQVTPGQVMVASTVAKLATIIDAEE
980 -> 1040 IAAAFSSLLGCDVQDADADFFALGGHSLLAMKLAAQLSRQVARQVTPGQVMVASTVAKLAT
1 -> 301 MSQHLPLVAAQPGIWMAEKLSELPSAWSVAHYVELTGEVDSPLLARAVVAGLAQADTLRMRFTEDNGEVWQWVDDALTFELPEIIDLRTNIDPHGTAQALMQADLQQDLRVDSGKPLVFHQLIQVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCTWLRGEPTPASPFTPFADVVEEYQQYRESEAWQRDAAFWAEQRRQLPPPASLSPAPLPGRSASADILRLKLEFTDGEFRQLATQLSGVQRTDLALALAALWLGRLCNRMDYAAGFIFMRRLGSAALTATGPVLNVLPLGIHIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.5 - Coenzyme A and its modification
  2 - information transfer --> 2.3 - protein related --> 2.3.9 - Non-ribosomal peptide synthetase
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009366 - enterobactin synthetase complex
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0016788 - hydrolase activity, acting on ester bonds
GO:0016740 - transferase activity
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0031177 - phosphopantetheine binding
GO:0047527 - 2,3-dihydroxybenzoate-serine ligase activity
biological_process GO:0008152 - metabolic process
GO:0009058 - biosynthetic process
GO:0009239 - enterobactin biosynthetic process
GO:0043041 - amino acid activation for nonribosomal peptide biosynthetic process
GO:0044550 - secondary metabolite biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Ehmann DE., et al., 2000
[2] Gehring AM., et al., 1998
[3] Miller BR., et al., 2014
[4] Zhou Z., et al., 2007
External database links:  
DIP:
DIP-9516N
ECOCYC:
ENTF-MONOMER
ECOLIWIKI:
b0586
INTERPRO:
IPR025110
INTERPRO:
IPR036736
INTERPRO:
IPR029058
INTERPRO:
IPR023213
INTERPRO:
IPR020845
INTERPRO:
IPR020806
INTERPRO:
IPR020802
INTERPRO:
IPR010071
INTERPRO:
IPR009081
INTERPRO:
IPR006162
INTERPRO:
IPR001242
INTERPRO:
IPR001031
INTERPRO:
IPR000873
MODBASE:
P11454
PDB:
5JA2
PDB:
5T3D
PDB:
2ROQ
PDB:
5JA1
PDB:
3TEJ
PFAM:
PF00668
PFAM:
PF00550
PFAM:
PF00975
PFAM:
PF13193
PFAM:
PF00501
PRIDE:
P11454
PRODB:
PRO_000022524
PROSITE:
PS50075
PROSITE:
PS00455
PROSITE:
PS00012
PROTEINMODELPORTAL:
P11454
REFSEQ:
NP_415118
SMART:
SM00823
SMART:
SM00824
SMR:
P11454
UNIPROT:
P11454


Operon      
Name: fes-ybdZ-entF-fepE         
Operon arrangement:
Transcription unit        Promoter
fes-ybdZ-entF-fepE


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, H-NS
Repressed by: Fur
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| iron(2+) sulfate (anhydrous) 20 µM; sodium citrate 10 mM| early exponential phase
E: Escherichia coli| LB medium| 2,2?-bipyridine 200 µM| early exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ehmann DE., Shaw-Reid CA., Losey HC., Walsh CT., 2000, The EntF and EntE adenylation domains of Escherichia coli enterobactin synthetase: sequestration and selectivity in acyl-AMP transfers to thiolation domain cosubstrates., Proc Natl Acad Sci U S A 97(6):2509-14

 [2] Gehring AM., Mori I., Walsh CT., 1998, Reconstitution and characterization of the Escherichia coli enterobactin synthetase from EntB, EntE, and EntF., Biochemistry 37(8):2648-59

 [3] Miller BR., Sundlov JA., Drake EJ., Makin TA., Gulick AM., 2014, Analysis of the linker region joining the adenylation and carrier protein domains of the modular nonribosomal peptide synthetases., Proteins 82(10):2691-702

 [4] Zhou Z., Lai JR., Walsh CT., 2007, Directed evolution of aryl carrier proteins in the enterobactin synthetase., Proc Natl Acad Sci U S A 104(28):11621-6


RegulonDB