RegulonDB RegulonDB 10.7: Gene Form
   

envY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompT ybcH envY PhoP OmrB OmrA ompTp ompTp TSS_695 (cluster) TSS_695 (cluster) TSS_694 TSS_694 TSS_693 TSS_693 TSS_692 TSS_692 TSS_691 TSS_691 TSS_690 (cluster) TSS_690 (cluster) TSS_689 TSS_689 TSS_688 TSS_688

Gene      
Name: envY    Texpresso search in the literature
Synonym(s): ECK0558, EG10268, b0566
Genome position(nucleotides): 586147 <-- 586908 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.33
External database links:  
ASAP:
ABE-0001935
CGSC:
18406
ECHOBASE:
EB0264
OU-MICROARRAY:
b0566
PORTECO:
envY
REGULONDB:
b0566
STRING:
511145.b0566
M3D: envY
COLOMBOS: envY
PortEco: b0566


Product      
Name: DNA-binding transcriptional activator EnvY
Synonym(s): EnvY, envelope protein; thermoregulation of porin biosynthesis
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol,outer membrane
Molecular weight: 29.019
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
149 -> 246 DSVCRIIQSDIQHYWNLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGYSSTSYFISVFKAFYGLTPLNYLAK
150 -> 150 S
213 -> 236 ITQVAQLCGYSSTSYFISVFKAFY
93 -> 93 R
169 -> 245 ASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGYSSTSYFISVFKAFYGLTPLNYLA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009266 - response to temperature stimulus
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Lundrigan MD., et al., 1989
External database links:  
ECOCYC:
PD00969
ECOLIWIKI:
b0566
INTERPRO:
IPR009057
INTERPRO:
IPR018060
INTERPRO:
IPR018062
INTERPRO:
IPR020449
MODBASE:
P10805
PFAM:
PF12833
PRIDE:
P10805
PRINTS:
PR00032
PRODB:
PRO_000022526
PROSITE:
PS00041
PROSITE:
PS01124
PROTEINMODELPORTAL:
P10805
REFSEQ:
NP_415098
SMART:
SM00342
SMR:
P10805
UNIPROT:
P10805


Operon      
Name: envY-ompT         
Operon arrangement:
Transcription unit        Promoter
ompT
envY-ompT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_688 585378 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_689 585380 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_690 (cluster) 585383 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_691 585398 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_692 585408 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_693 585420 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_694 585594 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_695 (cluster) 585659 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lundrigan MD., Friedrich MJ., Kadner RJ., 1989, Nucleotide sequence of the Escherichia coli porin thermoregulatory gene envY., Nucleic Acids Res 17(2):800

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB