RegulonDB RegulonDB 10.6.3: Gene Form
   

fabA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycbZ fabA rmf FadR FabR TSS_1257 TSS_1257 TSS_1256 TSS_1256 TSS_1255 (cluster) TSS_1255 (cluster) TSS_1254 TSS_1254 TSS_1253 TSS_1253 TSS_1252 TSS_1252 fabAp fabAp TSS_1251 (cluster) TSS_1251 (cluster) TSS_1250 TSS_1250 TSS_1249 TSS_1249

Gene      
Name: fabA    Texpresso search in the literature
Synonym(s): ECK0945, EG10273, b0954
Genome position(nucleotides): 1015952 <-- 1016470 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.18
Reference(s): [1] Cronan JE., et al., 1988
[2] Cronan JE., et al., 1972
[3] Feng Y., et al., 2009
[4] Feng Y., et al., 2011
[5] Henry MF., et al., 1992
[6] Nunn WD., et al., 1983
External database links:  
ASAP:
ABE-0003229
CGSC:
799
ECHOBASE:
EB0269
ECOCYC:
EG10273
ECOLIHUB:
fabA
OU-MICROARRAY:
b0954
REGULONDB:
b0954
STRING:
511145.b0954
M3D: fabA
COLOMBOS: fabA
PortEco: b0954


Product      
Name: β-hydroxyacyl-acyl carrier protein dehydratase/isomerase
Synonym(s): beta;-hydroxyacyl-ACP dehydratase/isomerase, FabA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.969
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
2 -> 172 VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF
29 -> 158 LPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTA
102 -> 102 G
76 -> 76 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008659 - (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase activity
GO:0016829 - lyase activity
GO:0016853 - isomerase activity
GO:0008693 - 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity
GO:0019171 - 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity
GO:0042803 - protein homodimerization activity
GO:0034017 - trans-2-decenoyl-acyl-carrier-protein isomerase activity
GO:0047451 - 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0008610 - lipid biosynthetic process
GO:0006633 - fatty acid biosynthetic process
External database links:  
DIP:
DIP-31864N
ECOCYC:
FABA-MONOMER
ECOLIWIKI:
b0954
INTERPRO:
IPR029069
INTERPRO:
IPR010083
INTERPRO:
IPR013114
MINT:
MINT-1218658
PANTHER:
PTHR30272:SF8
PDB:
4KEH
PDB:
1MKB
PDB:
1MKA
PFAM:
PF07977
PRIDE:
P0A6Q3
PRODB:
PRO_000022559
PROTEINMODELPORTAL:
P0A6Q3
REFSEQ:
NP_415474
SMR:
P0A6Q3
UNIPROT:
P0A6Q3


Operon      
Name: fabA         
Operon arrangement:
Transcription unit        Promoter
fabA


Transcriptional Regulation      
Display Regulation             
Activated by: FadR
Repressed by: FabR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1249 1016472 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1250 1016488 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1251 (cluster) 1016497 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1252 1016859 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1253 1017045 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1254 1017052 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1255 (cluster) 1017834 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1256 1017837 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1257 1017843 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cronan JE., Li WB., Coleman R., Narasimhan M., de Mendoza D., Schwab JM., 1988, Derived amino acid sequence and identification of active site residues of Escherichia coli beta-hydroxydecanoyl thioester dehydrase., J Biol Chem 263(10):4641-6

 [2] Cronan JE., Silbert DF., Wulff DL., 1972, Mapping of the fabA locus for unsaturated fatty acid biosynthesis in Escherichia coli., J Bacteriol 112(1):206-11

 [3] Feng Y., Cronan JE., 2009, Escherichia coli unsaturated fatty acid synthesis: complex transcription of the fabA gene and in vivo identification of the essential reaction catalyzed by FabB., J Biol Chem 284(43):29526-35

 [4] Feng Y., Cronan JE., 2011, Complex binding of the FabR repressor of bacterial unsaturated fatty acid biosynthesis to its cognate promoters., Mol Microbiol 80(1):195-218

 [5] Henry MF., Cronan JE., 1992, A new mechanism of transcriptional regulation: release of an activator triggered by small molecule binding., Cell 70(4):671-9

 [6] Nunn WD., Giffin K., Clark D., Cronan JE., 1983, Role for fadR in unsaturated fatty acid biosynthesis in Escherichia coli., J Bacteriol 154(2):554-60

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB