RegulonDB RegulonDB 10.9: Gene Form
   

accB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

accC yhdH accB yrdE yrdF b3254 FadR anti-anti-terminator anti-terminator accBp2 accBp2 accBp accBp TSS_3590 TSS_3590 TSS_3589 TSS_3589

Gene      
Name: accB    Texpresso search in the literature
Synonym(s): ECK3242, EG10275, b3255, fabE
Genome position(nucleotides): 3405436 --> 3405906 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.8
External database links:  
ASAP:
ABE-0010675
CGSC:
796
ECHOBASE:
EB0271
ECOLIHUB:
accB
OU-MICROARRAY:
b3255
STRING:
511145.b3255
COLOMBOS: accB


Product      
Name: biotin carboxyl carrier protein
Synonym(s): AccB, BCCP, FabE, apo-[acetyl-CoA:carbon-dioxide ligase (ADP forming)]
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.687
Isoelectric point: 4.317
Motif(s):
 
Type Positions Sequence
73 -> 156 PAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
83 -> 155 VRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVI
113 -> 113 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.3 - biotin carboxyl carrier protein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009317 - acetyl-CoA carboxylase complex
molecular_function GO:0005515 - protein binding
GO:0003989 - acetyl-CoA carboxylase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
GO:0009305 - protein biotinylation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Alix JH. 1989
[2] Chapman-Smith A., et al., 1994
[3] Muramatsu S., et al., 1989
[4] Wachi M., et al., 1987
External database links:  
DIP:
DIP-48007N
DISPROT:
DP00970
ECOCYC:
BCCP-MONOMER
ECOLIWIKI:
b3255
INTERPRO:
IPR001249
INTERPRO:
IPR011053
INTERPRO:
IPR001882
INTERPRO:
IPR000089
MODBASE:
P0ABD8
PDB:
4HR7
PDB:
2BDO
PDB:
3BDO
PDB:
1K69
PDB:
1A6X
PDB:
1K67
PDB:
1BDO
PFAM:
PF00364
PRIDE:
P0ABD8
PRINTS:
PR01071
PRODB:
PRO_000022033
PROSITE:
PS00188
PROSITE:
PS50968
REFSEQ:
NP_417721
SMR:
P0ABD8
UNIPROT:
P0ABD8


Operon      
Name: accBC         
Operon arrangement:
Transcription unit        Promoter
accBC
accBC


Transcriptional Regulation      
Display Regulation             
Activated by: FadR
Repressed by: AccB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3589 3403932 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3590 3404746 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alix JH., 1989, A rapid procedure for cloning genes from lambda libraries by complementation of E. coli defective mutants: application to the fabE region of the E. coli chromosome., DNA 8(10):779-89

 [2] Chapman-Smith A., Turner DL., Cronan JE., Morris TW., Wallace JC., 1994, Expression, biotinylation and purification of a biotin-domain peptide from the biotin carboxy carrier protein of Escherichia coli acetyl-CoA carboxylase., Biochem J 302 ( Pt 3):881-7

 [3] Muramatsu S., Mizuno T., 1989, Nucleotide sequence of the fabE gene and flanking regions containing a bent DNA sequence of Escherichia coli., Nucleic Acids Res 17(10):3982

 [4] Wachi M., Doi M., Tamaki S., Park W., Nakajima-Iijima S., Matsuhashi M., 1987, Mutant isolation and molecular cloning of mre genes, which determine cell shape, sensitivity to mecillinam, and amount of penicillin-binding proteins in Escherichia coli., J Bacteriol 169(11):4935-40

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB