RegulonDB RegulonDB 10.8: Gene Form
   

fabH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

plsX fabH fabD FadR DksA-ppGpp DksA-ppGpp TSS_1399 TSS_1399 TSS_1398 TSS_1398 TSS_1397 TSS_1397 TSS_1396 TSS_1396 TSS_1395 TSS_1395 TSS_1394 TSS_1394 TSS_1393 TSS_1393 TSS_1392 TSS_1392 TSS_1391 TSS_1391 TSS_1390 TSS_1390 TSS_1389 TSS_1389 fabHp fabHp TSS_1388 TSS_1388 TSS_1387 TSS_1387

Gene      
Name: fabH    Texpresso search in the literature
Synonym(s): ECK1077, EG10277, b1091
Genome position(nucleotides): 1148759 --> 1149712 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.72
Reference(s): [1] Tsay JT., et al., 1992
External database links:  
ASAP:
ABE-0003696
CGSC:
31860
ECHOBASE:
EB0273
OU-MICROARRAY:
b1091
PortEco:
fabH
STRING:
511145.b1091
COLOMBOS: fabH


Product      
Name: β-ketoacyl-[acyl carrier protein] synthase III
Synonym(s): beta;-ketoacyl-ACP synthase III, FabH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.515
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
228 -> 316 LAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVR
245 -> 249 QANLR
249 -> 249 R
244 -> 244 H
112 -> 112 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004315 - 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0042803 - protein homodimerization activity
GO:0033818 - beta-ketoacyl-acyl-carrier-protein synthase III activity
biological_process GO:0008152 - metabolic process
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
External database links:  
DIP:
DIP-48255N
ECOCYC:
FABH-MONOMER
ECOLIWIKI:
b1091
INTERPRO:
IPR004655
INTERPRO:
IPR013747
INTERPRO:
IPR013751
INTERPRO:
IPR016039
MINT:
MINT-1263292
MODBASE:
P0A6R0
PDB:
4Z8D
PDB:
5BNM
PDB:
5BNR
PDB:
5BNS
PDB:
3IL9
PDB:
2EFT
PDB:
1MZS
PDB:
1HNK
PDB:
1HNJ
PDB:
1HNH
PDB:
1HND
PDB:
1HN9
PDB:
1EBL
PDB:
2GYO
PFAM:
PF08545
PFAM:
PF08541
PRIDE:
P0A6R0
PRODB:
PRO_000022564
REFSEQ:
NP_415609
SMR:
P0A6R0
UNIPROT:
P0A6R0


Operon      
Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter
yceD-rpmF
yceD-rpmF
rpmF-plsX-fabHDG
plsX-fabHDG
fabHDG
acpP
acpP-fabF
fabDG-acpP
fabF
fabG-acpP


Transcriptional Regulation      
Display Regulation             
Activated by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1387 1147771 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1388 1148362 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1389 1149153 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1390 1149156 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1391 1149172 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1392 1149706 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1393 1150045 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1394 1150372 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1395 1150404 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1396 1150416 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1397 1150443 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1398 1150491 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1399 1150589 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Tsay JT., Oh W., Larson TJ., Jackowski S., Rock CO., 1992, Isolation and characterization of the beta-ketoacyl-acyl carrier protein synthase III gene (fabH) from Escherichia coli K-12., J Biol Chem 267(10):6807-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB