RegulonDB RegulonDB 10.7: Gene Form
   

fadL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadL yfdF yfcZ OmpR OmpR FadR FadR ArcA OmpR OmpR CRP PhoP ppGpp anti-anti-terminator anti-terminator yfdFp8 yfdFp8 yfdFp7 yfdFp7 yfdFp9 yfdFp9 yfdFp4 yfdFp4 fadLp fadLp yfcZp yfcZp TSS_2653 TSS_2653

Gene      
Name: fadL    Texpresso search in the literature
Synonym(s): ECK2338, EG10280, b2344, ttr
Genome position(nucleotides): 2461306 --> 2462646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.81
External database links:  
ASAP:
ABE-0007740
CGSC:
790
ECHOBASE:
EB0276
OU-MICROARRAY:
b2344
PORTECO:
fadL
REGULONDB:
b2344
STRING:
511145.b2344
M3D: fadL
COLOMBOS: fadL
PortEco: b2344


Product      
Name: long-chain fatty acid outer membrane channel / bacteriophage T2 receptor
Synonym(s): FadL, Ttr
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 48.542
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
1 -> 25 MSQKTLFTKSALAVAVALISTQAWS
26 -> 67 AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDR
176 -> 178 ARA
28 -> 28 F
108 -> 108 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0031230 - intrinsic component of cell outer membrane
molecular_function GO:0022834 - ligand-gated channel activity
GO:0015483 - long-chain fatty acid transporting porin activity
biological_process GO:0006869 - lipid transport
GO:0015908 - fatty acid transport
GO:0055085 - transmembrane transport
GO:0015909 - long-chain fatty acid transport
Note(s): Note(s): ...[more].
Evidence: [IFC] Inferred by functional complementation
[IMP] Inferred from mutant phenotype
Reference(s): [1] Azizan A., et al., 1999
[2] Black PN. 1988
[3] Black PN., et al., 1985
[4] Burgess NK., et al., 2008
[5] Ginsburgh CL., et al., 1984
[6] Morona R., et al., 1986
[7] Nunn WD., et al., 1986
[8] Nunn WD., et al., 1979
[9] Zhang DF., et al., 2018
External database links:  
ECOCYC:
EG10280-MONOMER
ECOLIWIKI:
b2344
INTERPRO:
IPR005017
INTERPRO:
IPR042117
MODBASE:
P10384
PANTHER:
PTHR35093
PDB:
2R89
PDB:
2R8A
PDB:
3DWN
PDB:
3PF1
PDB:
3PGR
PDB:
3PGS
PDB:
3PGU
PDB:
2R88
PDB:
2R4P
PDB:
2R4O
PDB:
2R4N
PDB:
2R4L
PDB:
1T1L
PDB:
1T16
PFAM:
PF03349
PRIDE:
P10384
PRODB:
PRO_000022572
PROTEINMODELPORTAL:
P10384
REFSEQ:
NP_416846
SMR:
P10384
UNIPROT:
P10384


Operon      
Name: fadL         
Operon arrangement:
Transcription unit        Promoter
fadL


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoP
Repressed by: OmpR, FadR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2653 2460973 reverse nd [RS-EPT-CBR] [10]
  promoter yfdFp4 2462802 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter yfdFp9 2462982 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter yfdFp7 2462984 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter yfdFp8 2462985 forward Similarity to the consensus
Read more >
[ICWHO] [11]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Azizan A., Sherin D., DiRusso CC., Black PN., 1999, Energetics underlying the process of long-chain fatty acid transport., Arch Biochem Biophys 365(2):299-306

 [2] Black PN., 1988, The fadL gene product of Escherichia coli is an outer membrane protein required for uptake of long-chain fatty acids and involved in sensitivity to bacteriophage T2., J Bacteriol 170(6):2850-4

 [3] Black PN., Kianian SF., DiRusso CC., Nunn WD., 1985, Long-chain fatty acid transport in Escherichia coli. Cloning, mapping, and expression of the fadL gene., J Biol Chem 260(3):1780-9

 [4] Burgess NK., Dao TP., Stanley AM., Fleming KG., 2008, Beta-barrel proteins that reside in the Escherichia coli outer membrane in vivo demonstrate varied folding behavior in vitro., J Biol Chem 283(39):26748-58

 [5] Ginsburgh CL., Black PN., Nunn WD., 1984, Transport of long chain fatty acids in Escherichia coli. Identification of a membrane protein associated with the fadL gene., J Biol Chem 259(13):8437-43

 [6] Morona R., Henning U., 1986, New locus (ttr) in Escherichia coli K-12 affecting sensitivity to bacteriophage T2 and growth on oleate as the sole carbon source., J Bacteriol 168(2):534-40

 [7] Nunn WD., Colburn RW., Black PN., 1986, Transport of long-chain fatty acids in Escherichia coli. Evidence for role of fadL gene product as long-chain fatty acid receptor., J Biol Chem 261(1):167-71

 [8] Nunn WD., Simons RW., Egan PA., Maloy SR., 1979, Kinetics of the utilization of medium and long chain fatty acids by mutant of Escherichia coli defective in the fadL gene., J Biol Chem 254(18):9130-4

 [9] Zhang DF., Ye JZ., Dai HH., Lin XM., Li H., Peng XX., 2018, Identification of ethanol tolerant outer membrane proteome reveals OmpC-dependent mechanism in a manner of EnvZ/OmpR regulation in Escherichia coli., J Proteomics 179:92-99

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [11] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB